KEGG   Xenopus tropicalis (western clawed frog): 100124862Help
Entry
100124862         CDS       T01011                                 

Gene name
pdgfra, pdgfr-alpha, pdgfr2, pdgfralpha
Definition
(RefSeq) platelet-derived growth factor receptor, alpha polypeptide
  KO
K04363  
platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Cytokine-cytokine receptor interaction
Endocytosis
Focal adhesion
Gap junction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100124862 (pdgfra)
   04020 Calcium signaling pathway
    100124862 (pdgfra)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100124862 (pdgfra)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100124862 (pdgfra)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100124862 (pdgfra)
   04540 Gap junction
    100124862 (pdgfra)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100124862 (pdgfra)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100124862 (pdgfra)
Protein kinases [BR:xtr01001]
 Tyrosine protein kinases
  PDGFR family [OT]
   100124862 (pdgfra)
Enzyme-linked receptors [BR:xtr01020]
 Receptor tyrosine kinases
  RTK class III (PDGF receptor family)
   100124862 (pdgfra)
Cytokine receptors [BR:xtr04050]
 Receptor tyrosine kinase
  RTK class III (PDGF receptor family)
   100124862 (pdgfra)
Cellular antigens [BR:xtr04090]
 Proteins
  100124862 (pdgfra)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
1
AA seq 1091 aa AA seqDB search
MMPTTRASLVLGCLLIIGPWVILAQNPLPSIFPEKDELVQRLHSSFSLTCTGESELSWQH
PHSESELGNVVIGSEENNSGLFVSVLEVTNASASNTGLYTCYYNHTQTEDSEIEGTDIYI
YVPDTNVPFVPPGLFDHIIVVEEDESAFIPCRTTDPSSQVTLKSIENSKTVSAFYDSKQG
FVGNFQPGSYICETVSNKMVYQTDLYILQTWKATHNISVEMEAPQTVFRTGETITISCIV
LENEVVELKWYYPGQQRGVGKRNVEESRVPSQRLVYTLTIANATADDSGEYQCAVLHATL
DNKVIKKTNITVHEKGFINLEPMFGSEEYANLHEVKSFIVDLHAYPCPRVFWLKDNRTLS
ENLTEITTSTVTTKETRFQSKLKLIRAKEEDSGLYTLVAQNDAETKSYSFILQIKVPALI
LELVDEHHGTSGEQTVGCLAKGMPVPDVEWLVCKDIKRCNNDTLWSLLAINGSEISMETH
QDYENTIESQVTFKKVEETMAIRCIARNDLGVVARELKLVAPTLRSELTVAAAVLVLLVI
VIISLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFQRDGLVLGR
ILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGAHLNI
VNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFQSRHPEKSKKDLDIFGLNPADEST
RSYVILSFENNGDYMDMKQADTMQYVPMLEMKEPSKYSDIQRSLYDRPASYKKKPLSEVK
NILSDDGFDGFDGLTVLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAHGKIVKICD
FGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSFGILLWEIFSLGGTPY
PGMIVDSTFYNKIKSGYRMAKPDHATHEVYDIMVKCWNSEPEKRPSFRHLSDIVESLLPM
EYKRCYETVLHDFLKSDHPAVTRMRSDSDNSYIGVTYKNENKMKDRESGFDEQRLSADSG
YIIPLPDIDPVSEDESSKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIEMMDDIGI
DSSDLVEDSFL
NT seq 3276 nt NT seq  +upstreamnt  +downstreamnt
atgatgcctaccacgagggcatcccttgttttggggtgtctcctgattataggtccgtgg
gtcattcttgctcaaaatcccctgccctcaatatttcctgaaaaggatgagttggttcag
aggttgcactcctccttttcactaacgtgcactggtgagagcgaactgagctggcagcac
ccccattccgaatctgaactggggaatgtagtcattggaagtgaagaaaacaacagcggc
ctctttgtgtctgttctggaagtgaccaacgcttccgcctccaatacgggcctctacacc
tgctactacaatcacacccagactgaggacagtgagattgaaggcactgatatctacatc
tatgtcccagacaccaatgtcccttttgttccccccgggttgtttgaccatatcattgtg
gttgaggaagatgaatctgctttcataccttgtcgcactaccgacccttccagccaagtg
accctaaaaagtatcgaaaattctaagactgtcagtgccttttatgacagcaagcaagga
tttgttggaaacttccaaccaggatcatacatctgtgaaaccgtctctaacaaaatggtc
taccagacagacctttacattctacagacatggaaagcaacgcacaacatttccgttgag
atggaagccccccaaactgtatttcgaactggggaaaccattaccatttcctgcattgtg
ctggagaatgaggtggtagaattgaagtggtactaccctggacaacagagaggcgttggc
aaaagaaatgttgaagaaagcagggttccatctcagagactggtgtacaccttaaccatt
gcaaatgccactgcggatgactcaggagagtaccagtgtgccgttctacatgcaacacta
gataacaaggtcatcaagaagacaaatataacagttcatgaaaagggattcatcaatctg
gagcccatgtttggatctgaggaatatgccaacctccatgaagtgaagagctttatagta
gacttgcatgcctatccctgccctagggtcttctggttgaaggacaaccggacactgagt
gaaaatctgacagagatcacgactagcactgttacaactaaagaaaccaggtttcagagt
aaacttaaactgatccgggccaaagaagaagacagcggactgtacactcttgtggcacaa
aatgacgcagaaactaaaagctactcgtttattttgcagataaaagtacccgctttgata
ttggaactggttgatgaacatcatgggacatctggtgaacagactgttgggtgcttagcc
aaagggatgccggtccctgatgtggaatggttggtctgcaaagacatcaaaagatgcaac
aatgacaccttgtggtcccttctggcaataaatgggtcagaaatcagtatggagacccat
caagattatgagaacacaatagaaagccaggtgacctttaagaaagttgaggagacaatg
gcaatccgatgtatcgcaagaaacgacctcggtgtggtggccagggaactaaagctggtt
gcacccaccctacgttctgaactaactgtggcagccgccgtccttgtccttctggtgatt
gtcatcatatctctcattgtactggtcatcatatggaaacagaaaccaaggtatgaaata
agatggcgagtgatcgagtccatcagcccagatggccatgaatatatctatgtggaccca
atgcagcttccttatgactctcggtgggagttccaaagggatggacttgttcttggtcgc
atccttggctctggggcttttgggaaagtggttgaaggcacagcatatgggttaagtcgt
tctcagccagttatgaaagttgctgtaaaaatgttgaaacctactgcccggtcaagcgaa
aagcaggcactgatgtctgaactgaagatcatgacacaccttggcgcacatctcaatata
gtcaatttattaggagcctgtactaagtcaggaccaatttatatcataactgaatactgc
ttctatggtgacctcgtgaattacctgcataagaaccgagataattttcagagccgacac
ccagagaaatcaaagaaggatttggacatctttgggctgaacccagctgacgagagtacg
agaagctatgttatcttatcatttgaaaacaacggcgactatatggacatgaaacaagct
gacaccatgcagtatgtacccatgctggaaatgaaagaaccctccaagtattcagatatc
cagagatccttgtatgaccggcctgcgtcgtacaagaagaagcctttgtcagaagtgaaa
aatatcttgtctgatgatggattcgatggattcgatggtctaacagtactggacttgctc
agtttcacatatcaagttgcaaggggcatggaattcttagcctctaaaaattgtgtacat
cgggatttggcagctcggaatgtcctattagcacatgggaaaattgtaaaaatctgtgac
tttggcctagcaagagacatcatgcacgactccaactatgtatccaaaggcagcactttc
cttccagtaaagtggatggcgcccgaaagcatcttcgataacctgtacacaactctcagc
gatgtgtggtcatttggaatcctgctgtgggaaatattttctcttgggggcacaccgtat
cctggcatgattgtggattcaaccttctataataagataaaaagtggctacagaatggca
aaacctgaccatgccacccatgaagtgtacgacatcatggtaaaatgttggaacagtgaa
ccagaaaaaaggccatcatttcgccatctgagtgacattgtggaaagtctacttcctatg
gaatacaaaaggtgctacgagacagttcttcatgatttccttaaaagtgaccaccctgca
gttactcgcatgagaagtgacagtgacaattcctacattggggtgacgtataagaatgaa
aacaaaatgaaggacagagagagtgggtttgatgagcaaaggctgagcgctgacagcggt
tacattattccccttcctgatattgatcccgtttcagaagatgagtccagcaagaggaac
aggcacagttctcaaacatcagaagaaagtgcaatcgagaccgggtccagcagttccact
tttataaagagggaggacgagaccattgaagacattgagatgatggacgacattgggatc
gattcctcggatctagtggaggacagtttcctgtaa

DBGET integrated database retrieval system