KEGG   Xenopus tropicalis (western clawed frog): 100124862Help
Entry
100124862         CDS       T01011                                 

Definition
uncharacterized LOC100124862
Orthology
K04363  
platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Cytokine-cytokine receptor interaction
Endocytosis
Focal adhesion
Gap junction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100124862
   04020 Calcium signaling pathway
    100124862
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100124862
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100124862
  Cell motility
   04810 Regulation of actin cytoskeleton
    100124862
  Cell communication
   04510 Focal adhesion
    100124862
   04540 Gap junction
    100124862
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100124862
Protein kinases [BR:xtr01001]
 Tyrosine protein kinases
  PDGFR family [OT]
   100124862
Enzyme-linked receptors [BR:xtr01020]
 Receptor tyrosine kinases
  RTK class III (PDGF receptor family)
   100124862
Cytokine receptors [BR:xtr04050]
 Receptor tyrosine kinase
  RTK class III (PDGF receptor family)
   100124862
Cellular antigens [BR:xtr04090]
 Proteins
  100124862
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 1091 aa AA seqDB search
MMPTTRASLVLGCLLIIGPWVILAQNPLPSIFPEKDELVQRLHSSFSLTCTGESELSWQH
PHSESELGNVVIGSEENNSGLFVSVLEVTNASASNTGLYTCYYNHTQTEDSEIEGTDIYI
YVPDTNVPFVPPGLFDHIIVVEEDESAFIPCRTTDPSSQVTLKSIENSKTVSAFYDSKQG
FVGNFQPGSYICETVSNKMVYQTDLYILQTWKATHNISVEMEAPQTVFRTGETITISCIV
LENEVVELKWYYPGQQRGVGKRNVEESRVPSQRLVYTLTIANATADDSGEYQCAVLHATL
DNKVIKKTNITVHEKGFINLEPMFGSEEYANLHEVKSFIVDLHAYPCPRVFWLKDNRTLS
ENLTEITTSTVTTKETRFQSKLKLIRAKEEDSGLYTLVAQNDAETKSYSFILQIKVPALI
LELVDEHHGTSGEQTVGCLAKGMPVPDVEWLVCKDIKRCNNDTLWSLLAINGSEISMETH
QDYENTIESQVTFKKVEETMAIRCIARNDLGVVARELKLVAPTLRSELTVAAAVLVLLVI
VIISLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFQRDGLVLGR
ILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGAHLNI
VNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFQSRHPEKSKKDLDIFGLNPADEST
RSYVILSFENNGDYMDMKQADTMQYVPMLEMKEPSKYSDIQRSLYDRPASYKKKPLSEVK
NILSDDGFDGFDGLTVLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAHGKIVKICD
FGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSFGILLWEIFSLGGTPY
PGMIVDSTFYNKIKSGYRMAKPDHATHEVYDIMVKCWNSEPEKRPSFRHLSDIVESLLPM
EYKRCYETVLHDFLKSDHPAVTRMRSDSDNSYIGVTYKNENKMKDRESGFDEQRLSADSG
YIIPLPDIDPVSEDESSKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIEMMDDIGI
DSSDLVEDSFL
NT seq 3276 nt NT seq  +upstreamnt  +downstreamnt
atgatgcctaccacgagggcatcccttgttttggggtgtctcctgattataggtccgtgg
gtcattcttgctcaaaatcccctgccctcaatatttcctgaaaaggatgagttggttcag
aggttgcactcctccttttcactaacgtgcactggtgagagcgaactgagctggcagcac
ccccattccgaatctgaactggggaatgtagtcattggaagtgaagaaaacaacagcggc
ctctttgtgtctgttctggaagtgaccaacgcttccgcctccaatacgggcctctacacc
tgctactacaatcacacccagactgaggacagtgagattgaaggcactgatatctacatc
tatgtcccagacaccaatgtcccttttgttccccccgggttgtttgaccatatcattgtg
gttgaggaagatgaatctgctttcataccttgtcgcactaccgacccttccagccaagtg
accctaaaaagtatcgaaaattctaagactgtcagtgccttttatgacagcaagcaagga
tttgttggaaacttccaaccaggatcatacatctgtgaaaccgtctctaacaaaatggtc
taccagacagacctttacattctacagacatggaaagcaacgcacaacatttccgttgag
atggaagccccccaaactgtatttcgaactggggaaaccattaccatttcctgcattgtg
ctggagaatgaggtggtagaattgaagtggtactaccctggacaacagagaggcgttggc
aaaagaaatgttgaagaaagcagggttccatctcagagactggtgtacaccttaaccatt
gcaaatgccactgcggatgactcaggagagtaccagtgtgccgttctacatgcaacacta
gataacaaggtcatcaagaagacaaatataacagttcatgaaaagggattcatcaatctg
gagcccatgtttggatctgaggaatatgccaacctccatgaagtgaagagctttatagta
gacttgcatgcctatccctgccctagggtcttctggttgaaggacaaccggacactgagt
gaaaatctgacagagatcacgactagcactgttacaactaaagaaaccaggtttcagagt
aaacttaaactgatccgggccaaagaagaagacagcggactgtacactcttgtggcacaa
aatgacgcagaaactaaaagctactcgtttattttgcagataaaagtacccgctttgata
ttggaactggttgatgaacatcatgggacatctggtgaacagactgttgggtgcttagcc
aaagggatgccggtccctgatgtggaatggttggtctgcaaagacatcaaaagatgcaac
aatgacaccttgtggtcccttctggcaataaatgggtcagaaatcagtatggagacccat
caagattatgagaacacaatagaaagccaggtgacctttaagaaagttgaggagacaatg
gcaatccgatgtatcgcaagaaacgacctcggtgtggtggccagggaactaaagctggtt
gcacccaccctacgttctgaactaactgtggcagccgccgtccttgtccttctggtgatt
gtcatcatatctctcattgtactggtcatcatatggaaacagaaaccaaggtatgaaata
agatggcgagtgatcgagtccatcagcccagatggccatgaatatatctatgtggaccca
atgcagcttccttatgactctcggtgggagttccaaagggatggacttgttcttggtcgc
atccttggctctggggcttttgggaaagtggttgaaggcacagcatatgggttaagtcgt
tctcagccagttatgaaagttgctgtaaaaatgttgaaacctactgcccggtcaagcgaa
aagcaggcactgatgtctgaactgaagatcatgacacaccttggcgcacatctcaatata
gtcaatttattaggagcctgtactaagtcaggaccaatttatatcataactgaatactgc
ttctatggtgacctcgtgaattacctgcataagaaccgagataattttcagagccgacac
ccagagaaatcaaagaaggatttggacatctttgggctgaacccagctgacgagagtacg
agaagctatgttatcttatcatttgaaaacaacggcgactatatggacatgaaacaagct
gacaccatgcagtatgtacccatgctggaaatgaaagaaccctccaagtattcagatatc
cagagatccttgtatgaccggcctgcgtcgtacaagaagaagcctttgtcagaagtgaaa
aatatcttgtctgatgatggattcgatggattcgatggtctaacagtactggacttgctc
agtttcacatatcaagttgcaaggggcatggaattcttagcctctaaaaattgtgtacat
cgggatttggcagctcggaatgtcctattagcacatgggaaaattgtaaaaatctgtgac
tttggcctagcaagagacatcatgcacgactccaactatgtatccaaaggcagcactttc
cttccagtaaagtggatggcgcccgaaagcatcttcgataacctgtacacaactctcagc
gatgtgtggtcatttggaatcctgctgtgggaaatattttctcttgggggcacaccgtat
cctggcatgattgtggattcaaccttctataataagataaaaagtggctacagaatggca
aaacctgaccatgccacccatgaagtgtacgacatcatggtaaaatgttggaacagtgaa
ccagaaaaaaggccatcatttcgccatctgagtgacattgtggaaagtctacttcctatg
gaatacaaaaggtgctacgagacagttcttcatgatttccttaaaagtgaccaccctgca
gttactcgcatgagaagtgacagtgacaattcctacattggggtgacgtataagaatgaa
aacaaaatgaaggacagagagagtgggtttgatgagcaaaggctgagcgctgacagcggt
tacattattccccttcctgatattgatcccgtttcagaagatgagtccagcaagaggaac
aggcacagttctcaaacatcagaagaaagtgcaatcgagaccgggtccagcagttccact
tttataaagagggaggacgagaccattgaagacattgagatgatggacgacattgggatc
gattcctcggatctagtggaggacagtttcctgtaa

DBGET integrated database retrieval system