KEGG   Xenopus tropicalis (western clawed frog): 100124862Help
Entry
100124862         CDS       T01011                                 

Definition
uncharacterized LOC100124862
Orthology
K04363  
platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Cytokine-cytokine receptor interaction
Endocytosis
Focal adhesion
Gap junction
Regulation of actin cytoskeleton
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:xtr04010]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:xtr04020]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:xtr04060]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:xtr04144]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:xtr04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:xtr04510]
Cellular Processes; Cell communication; Gap junction [PATH:xtr04540]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 1091 aa AA seqDB search
MMPTTRASLVLGCLLIIGPWVILAQNPLPSIFPEKDELVQRLHSSFSLTCTGESELSWQH
PHSESELGNVVIGSEENNSGLFVSVLEVTNASASNTGLYTCYYNHTQTEDSEIEGTDIYI
YVPDTNVPFVPPGLFDHIIVVEEDESAFIPCRTTDPSSQVTLKSIENSKTVSAFYDSKQG
FVGNFQPGSYICETVSNKMVYQTDLYILQTWKATHNISVEMEAPQTVFRTGETITISCIV
LENEVVELKWYYPGQQRGVGKRNVEESRVPSQRLVYTLTIANATADDSGEYQCAVLHATL
DNKVIKKTNITVHEKGFINLEPMFGSEEYANLHEVKSFIVDLHAYPCPRVFWLKDNRTLS
ENLTEITTSTVTTKETRFQSKLKLIRAKEEDSGLYTLVAQNDAETKSYSFILQIKVPALI
LELVDEHHGTSGEQTVGCLAKGMPVPDVEWLVCKDIKRCNNDTLWSLLAINGSEISMETH
QDYENTIESQVTFKKVEETMAIRCIARNDLGVVARELKLVAPTLRSELTVAAAVLVLLVI
VIISLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFQRDGLVLGR
ILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGAHLNI
VNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFQSRHPEKSKKDLDIFGLNPADEST
RSYVILSFENNGDYMDMKQADTMQYVPMLEMKEPSKYSDIQRSLYDRPASYKKKPLSEVK
NILSDDGFDGFDGLTVLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAHGKIVKICD
FGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSFGILLWEIFSLGGTPY
PGMIVDSTFYNKIKSGYRMAKPDHATHEVYDIMVKCWNSEPEKRPSFRHLSDIVESLLPM
EYKRCYETVLHDFLKSDHPAVTRMRSDSDNSYIGVTYKNENKMKDRESGFDEQRLSADSG
YIIPLPDIDPVSEDESSKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIEMMDDIGI
DSSDLVEDSFL
NT seq 3276 nt NT seq  +upstreamnt  +downstreamnt
atgatgcctaccacgagggcatcccttgttttggggtgtctcctgattataggtccgtgg
gtcattcttgctcaaaatcccctgccctcaatatttcctgaaaaggatgagttggttcag
aggttgcactcctccttttcactaacgtgcactggtgagagcgaactgagctggcagcac
ccccattccgaatctgaactggggaatgtagtcattggaagtgaagaaaacaacagcggc
ctctttgtgtctgttctggaagtgaccaacgcttccgcctccaatacgggcctctacacc
tgctactacaatcacacccagactgaggacagtgagattgaaggcactgatatctacatc
tatgtcccagacaccaatgtcccttttgttccccccgggttgtttgaccatatcattgtg
gttgaggaagatgaatctgctttcataccttgtcgcactaccgacccttccagccaagtg
accctaaaaagtatcgaaaattctaagactgtcagtgccttttatgacagcaagcaagga
tttgttggaaacttccaaccaggatcatacatctgtgaaaccgtctctaacaaaatggtc
taccagacagacctttacattctacagacatggaaagcaacgcacaacatttccgttgag
atggaagccccccaaactgtatttcgaactggggaaaccattaccatttcctgcattgtg
ctggagaatgaggtggtagaattgaagtggtactaccctggacaacagagaggcgttggc
aaaagaaatgttgaagaaagcagggttccatctcagagactggtgtacaccttaaccatt
gcaaatgccactgcggatgactcaggagagtaccagtgtgccgttctacatgcaacacta
gataacaaggtcatcaagaagacaaatataacagttcatgaaaagggattcatcaatctg
gagcccatgtttggatctgaggaatatgccaacctccatgaagtgaagagctttatagta
gacttgcatgcctatccctgccctagggtcttctggttgaaggacaaccggacactgagt
gaaaatctgacagagatcacgactagcactgttacaactaaagaaaccaggtttcagagt
aaacttaaactgatccgggccaaagaagaagacagcggactgtacactcttgtggcacaa
aatgacgcagaaactaaaagctactcgtttattttgcagataaaagtacccgctttgata
ttggaactggttgatgaacatcatgggacatctggtgaacagactgttgggtgcttagcc
aaagggatgccggtccctgatgtggaatggttggtctgcaaagacatcaaaagatgcaac
aatgacaccttgtggtcccttctggcaataaatgggtcagaaatcagtatggagacccat
caagattatgagaacacaatagaaagccaggtgacctttaagaaagttgaggagacaatg
gcaatccgatgtatcgcaagaaacgacctcggtgtggtggccagggaactaaagctggtt
gcacccaccctacgttctgaactaactgtggcagccgccgtccttgtccttctggtgatt
gtcatcatatctctcattgtactggtcatcatatggaaacagaaaccaaggtatgaaata
agatggcgagtgatcgagtccatcagcccagatggccatgaatatatctatgtggaccca
atgcagcttccttatgactctcggtgggagttccaaagggatggacttgttcttggtcgc
atccttggctctggggcttttgggaaagtggttgaaggcacagcatatgggttaagtcgt
tctcagccagttatgaaagttgctgtaaaaatgttgaaacctactgcccggtcaagcgaa
aagcaggcactgatgtctgaactgaagatcatgacacaccttggcgcacatctcaatata
gtcaatttattaggagcctgtactaagtcaggaccaatttatatcataactgaatactgc
ttctatggtgacctcgtgaattacctgcataagaaccgagataattttcagagccgacac
ccagagaaatcaaagaaggatttggacatctttgggctgaacccagctgacgagagtacg
agaagctatgttatcttatcatttgaaaacaacggcgactatatggacatgaaacaagct
gacaccatgcagtatgtacccatgctggaaatgaaagaaccctccaagtattcagatatc
cagagatccttgtatgaccggcctgcgtcgtacaagaagaagcctttgtcagaagtgaaa
aatatcttgtctgatgatggattcgatggattcgatggtctaacagtactggacttgctc
agtttcacatatcaagttgcaaggggcatggaattcttagcctctaaaaattgtgtacat
cgggatttggcagctcggaatgtcctattagcacatgggaaaattgtaaaaatctgtgac
tttggcctagcaagagacatcatgcacgactccaactatgtatccaaaggcagcactttc
cttccagtaaagtggatggcgcccgaaagcatcttcgataacctgtacacaactctcagc
gatgtgtggtcatttggaatcctgctgtgggaaatattttctcttgggggcacaccgtat
cctggcatgattgtggattcaaccttctataataagataaaaagtggctacagaatggca
aaacctgaccatgccacccatgaagtgtacgacatcatggtaaaatgttggaacagtgaa
ccagaaaaaaggccatcatttcgccatctgagtgacattgtggaaagtctacttcctatg
gaatacaaaaggtgctacgagacagttcttcatgatttccttaaaagtgaccaccctgca
gttactcgcatgagaagtgacagtgacaattcctacattggggtgacgtataagaatgaa
aacaaaatgaaggacagagagagtgggtttgatgagcaaaggctgagcgctgacagcggt
tacattattccccttcctgatattgatcccgtttcagaagatgagtccagcaagaggaac
aggcacagttctcaaacatcagaagaaagtgcaatcgagaccgggtccagcagttccact
tttataaagagggaggacgagaccattgaagacattgagatgatggacgacattgggatc
gattcctcggatctagtggaggacagtttcctgtaa

DBGET integrated database retrieval system