KEGG   Xenopus tropicalis (western clawed frog): 100124905Help
Entry
100124905         CDS       T01011                                 

Gene name
gck, glk, hhf3, hk4, hkiv, hxkp, mody2
Definition
glucokinase (hexokinase 4) (EC:2.7.1.2)
Orthology
K12407  
glucokinase [EC:2.7.1.2]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Butirosin and neomycin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:xtr01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:xtr00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:xtr00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xtr00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:xtr00520]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis [PATH:xtr00524]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:xtr04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 458 aa AA seqDB search
MEKFEQNEVDQILSEFHLQEEDLHVLMCRMQAEMERGLHLETNEEASVKMLPTYVRSTPD
GSEVGDFLALDLGGTNFRVMLVKVGEDLEGQWKVETKHKMYSIPEDAMTGTAEMLFDYIA
ECISDYLDQQNMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNNVVGLLRD
AIKRRGDFEMDVVAMVNDTVATMISCYYEDHHCEVGLIVGTGCNACYMEEMSNVELVEGE
EGRMCVNTEWGAFGDTGELEDFRLEYDRVVDEASLNPGQQLYEKMIGGKYMGELVRLVLI
KMVNENLIFGGESSEKLKTRGAFDTQFVSQIEADTSDFKQTLNILRTLGVQATIGDCHAV
RLACESVSTRAAVMCSSGLAAILNRMHQSRRGELSRITVGVDGSVYKLHPSFKDKFHATV
HKLTSGCEITFIQSEEGSGRGAALISAVAYKMAVLIGH
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagtttgaacagaacgaggtggatcaaatcctgtctgagttccatctccaggag
gaagatttgcatgttctgatgtgtaggatgcaggctgagatggagaggggtcttcacctg
gaaaccaatgaggaggccagtgttaaaatgctgcccacctatgttcgttctacacctgat
ggctccgaggtgggtgacttcctagccctggaccttgggggaaccaactttcgagtcatg
ttggtaaaggttggggaggatttggaagggcagtggaaagtggagacaaaacacaaaatg
tattcaattccagaggatgccatgactggaacagcggagatgctattcgactacattgca
gaatgcatttctgattacctggaccagcaaaacatgaaacacaagaaactgcccctggga
tttaccttctctttcccagttaggcatgaggatattgacaagggtattcttctcaactgg
accaaaggattcaaagcatctggagcagaaggaaacaatgttgttggactccttagagat
gctatcaagagacgtggtgattttgagatggatgtggttgccatggtgaatgatacagtg
gccactatgatatcttgttactatgaagaccatcactgtgaggttggcttgatcgtaggg
acaggttgtaacgcctgctacatggaggagatgagtaatgtggagttggtagaaggagag
gagggacgtatgtgtgtgaacacagagtggggagcatttggcgacacaggggaactggag
gatttccgtctggagtatgaccgagtggtggatgaggcatctcttaatcctggtcagcaa
ctctatgaaaagatgattggtggaaaatacatgggagagctggtgagactagtcctgata
aagatggtgaatgagaatctgatatttggaggagaatcttctgaaaagctgaagacccga
ggagcctttgacacacaatttgtgtcccagatagaggcggacacctcagattttaagcag
actctcaacatcctgcggactctaggggttcaggccacaattggagactgtcatgctgtg
cgcttagcatgtgagagtgtatctactcgagctgccgtcatgtgttcctctggccttgct
gcgatattgaaccgcatgcaccaaagcagaagaggggaactgtctcgaattacagtggga
gtcgatggatctgtgtacaaactacatcctagtttcaaagacaagttccatgccactgtg
cacaaactgacttcaggctgtgaaattaccttcattcagtcagaggaaggaagcgggcgt
ggtgctgccctaatatcagcagtggcgtataagatggctgtcctgattggtcactag

DBGET integrated database retrieval system