KEGG   Xenopus tropicalis (western clawed frog): 100124905Help
Entry
100124905         CDS       T01011                                 

Gene name
gck, glk, hhf3, hk4, hkiv, hxkp, mody2
Definition
glucokinase (hexokinase 4) (EC:2.7.1.2)
Orthology
K12407  
glucokinase [EC:2.7.1.2]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Butirosin and neomycin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100124905 (gck)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100124905 (gck)
   00052 Galactose metabolism
    100124905 (gck)
   00500 Starch and sucrose metabolism
    100124905 (gck)
   00520 Amino sugar and nucleotide sugar metabolism
    100124905 (gck)
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    100124905 (gck)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100124905 (gck)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     100124905 (gck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 458 aa AA seqDB search
MEKFEQNEVDQILSEFHLQEEDLHVLMCRMQAEMERGLHLETNEEASVKMLPTYVRSTPD
GSEVGDFLALDLGGTNFRVMLVKVGEDLEGQWKVETKHKMYSIPEDAMTGTAEMLFDYIA
ECISDYLDQQNMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNNVVGLLRD
AIKRRGDFEMDVVAMVNDTVATMISCYYEDHHCEVGLIVGTGCNACYMEEMSNVELVEGE
EGRMCVNTEWGAFGDTGELEDFRLEYDRVVDEASLNPGQQLYEKMIGGKYMGELVRLVLI
KMVNENLIFGGESSEKLKTRGAFDTQFVSQIEADTSDFKQTLNILRTLGVQATIGDCHAV
RLACESVSTRAAVMCSSGLAAILNRMHQSRRGELSRITVGVDGSVYKLHPSFKDKFHATV
HKLTSGCEITFIQSEEGSGRGAALISAVAYKMAVLIGH
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagtttgaacagaacgaggtggatcaaatcctgtctgagttccatctccaggag
gaagatttgcatgttctgatgtgtaggatgcaggctgagatggagaggggtcttcacctg
gaaaccaatgaggaggccagtgttaaaatgctgcccacctatgttcgttctacacctgat
ggctccgaggtgggtgacttcctagccctggaccttgggggaaccaactttcgagtcatg
ttggtaaaggttggggaggatttggaagggcagtggaaagtggagacaaaacacaaaatg
tattcaattccagaggatgccatgactggaacagcggagatgctattcgactacattgca
gaatgcatttctgattacctggaccagcaaaacatgaaacacaagaaactgcccctggga
tttaccttctctttcccagttaggcatgaggatattgacaagggtattcttctcaactgg
accaaaggattcaaagcatctggagcagaaggaaacaatgttgttggactccttagagat
gctatcaagagacgtggtgattttgagatggatgtggttgccatggtgaatgatacagtg
gccactatgatatcttgttactatgaagaccatcactgtgaggttggcttgatcgtaggg
acaggttgtaacgcctgctacatggaggagatgagtaatgtggagttggtagaaggagag
gagggacgtatgtgtgtgaacacagagtggggagcatttggcgacacaggggaactggag
gatttccgtctggagtatgaccgagtggtggatgaggcatctcttaatcctggtcagcaa
ctctatgaaaagatgattggtggaaaatacatgggagagctggtgagactagtcctgata
aagatggtgaatgagaatctgatatttggaggagaatcttctgaaaagctgaagacccga
ggagcctttgacacacaatttgtgtcccagatagaggcggacacctcagattttaagcag
actctcaacatcctgcggactctaggggttcaggccacaattggagactgtcatgctgtg
cgcttagcatgtgagagtgtatctactcgagctgccgtcatgtgttcctctggccttgct
gcgatattgaaccgcatgcaccaaagcagaagaggggaactgtctcgaattacagtggga
gtcgatggatctgtgtacaaactacatcctagtttcaaagacaagttccatgccactgtg
cacaaactgacttcaggctgtgaaattaccttcattcagtcagaggaaggaagcgggcgt
ggtgctgccctaatatcagcagtggcgtataagatggctgtcctgattggtcactag

  All links  
No link information was found.   
DBGET integrated database retrieval system