KEGG   Xenopus tropicalis (western clawed frog): 100125100Help
Entry
100125100         CDS       T01011                                 

Gene name
ptprr, ec-ptp, pcptp1, ptp-sl, ptpbr7
Definition
protein tyrosine phosphatase, receptor type, R (EC:3.1.3.48)
Orthology
K04458  
receptor-type tyrosine-protein phosphatase R [EC:3.1.3.48]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100125100 (ptprr)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100125100 (ptprr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 656 aa AA seqDB search
MDTMCGYLPFLCCLLFIRATECFSGDNDHLLAVHQRKSGRPRFIYHHVQSIEKSLDLERQ
KLSDQNFHMPSHLHVGKFHPAGFDKSSFPRSHNRAQNLLAPSDTEVDVENLPIPQANVIL
VMLKMDVNKLNTTLLRKFRQGVAAALGLSPQQVHINRLNGRKNCVELFISPLNKKIGVPE
ALPSAEVLRSLNLHTLHQRLSHFGITEVSAEKNVLQGQHEADKLWTKEGFYTIVIFLSIF
VIIVTCLMVLYRLKEKIQFSLRQDKKNQEIHLSPLPAQPSPSQAKRPSSMVQHEHIPKAV
NVIVDPQCQGTFEIRPPLSAGPSPFKMKPVGLQERRGSNVSLTLDMSSLGMVEPFTVVPA
PREKVSIEYLQSATRVLTRQQLRHIVQSSHLLHTEFMEIPMNFVDPKELNIPSHGTKNRY
KTILPNPVSRVCLKTKNANDALSTYINANYIRGYGGEDKAFIATQGPMINTVNDFWQMVW
QEDVPVIVMITKLKEKNEKCVLYWPEKRGIYGGVEVLVNSVKECDYYTIRNLTLKQGSQS
RTVKHYWYTSWPDHKTPDSAQPLLQLMLDVQEDRKNFSGRGPVVVHCSAGIGRTGCFIST
SIGCCQLEEKGVVDVLNIVCQLRMDRGGMVQTSEQYQFVHHALSLYESRLSAETVQ
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggatacaatgtgcggctatttacccttcttgtgctgcttgcttttcattcgcgctaca
gagtgcttttctggcgacaatgatcatttattggcagttcaccagcggaagagtggaagg
cccaggtttatttaccaccacgtacaaagcattgagaagagcttagacctggaaaggcag
aagttatctgaccaaaatttccacatgccctcccacctgcatgttggcaaatttcatcct
gcagggttcgataaatcgtcttttccacgctctcataaccgcgcacaaaacctcttagct
ccaagtgacacagaggttgatgtagaaaaccttcctattccacaggccaatgtgattctg
gtgatgttgaaaatggatgtaaacaaactgaacacaacgttactccggaagtttcgtcag
ggagttgctgcagcccttggcttgtcgccacagcaagttcacatcaatcgtctcaatggt
agaaagaattgcgtagaactcttcatttctccactgaacaaaaaaataggtgttccggag
gcccttccttctgcagaagtcttacgttccctcaacttacacacgctgcaccaaagatta
tctcattttggaatcactgaagtctctgcagagaaaaatgtactccaaggacaacatgaa
gcagataaactatggaccaaagaaggattttacaccattgttatatttctcagcatattt
gtcataatagtgacttgcttaatggttctctacagattaaaagaaaagattcagttttca
ttgaggcaggacaaaaaaaatcaggagatccacctgtcgcctctcccagctcagccttca
ccatctcaggctaaacggccaagcagtatggtgcagcatgaacatatccctaaagctgtg
aatgttattgtagacccccagtgccaaggcacctttgagatcagacctcctctgtctgcg
ggaccttctccatttaaaatgaaacccgtaggcctccaagaaaggagaggctccaatgtg
tcacttactttagatatgagcagtttaggaatggtggaacctttcactgtggtaccggcc
ccaagagaaaaagtatccattgaatacttacagtcagccactcgagtcctgaccagacag
cagctcaggcatattgttcaaagctcccatttgcttcacactgaattcatggaaatacca
atgaattttgtggatcccaaagaacttaatattccaagccatggaaccaaaaatcgatat
aaaactatattgccaaatccagttagcagagtatgtttgaaaacaaagaacgcaaatgat
gcattaagcacctatataaatgctaattatattaggggttatggtggagaagacaaagct
tttattgccacacaaggtcccatgattaacactgtgaatgacttctggcaaatggtgtgg
caagaagatgtcccagttattgttatgatcaccaaactgaaagaaaaaaatgagaaatgt
gttctttactggccagaaaagagaggcatatatggaggtgttgaggtcctagttaatagt
gtaaaagaatgtgattattataccatccggaatcttacactaaagcaagggagtcagtct
cgtactgttaaacattactggtacacatcatggcccgatcacaagactccagacagtgcc
caacctctcctgcagcttatgttggatgtgcaagaagacaggaagaatttttcaggacgg
ggccctgtagtagtgcattgcagtgctggaatcggtaggactggctgtttcatctcaaca
tcaattggctgttgtcaactggaagagaaaggtgttgttgatgtattaaatattgtctgc
cagcttagaatggacaggggtggaatggttcaaacaagtgagcaatatcagtttgtgcac
catgcgctgagcttatatgaaagccgactatctgcagaaactgtccagtga

DBGET integrated database retrieval system