KEGG   Xenopus tropicalis (western clawed frog): 100125112Help
Entry
100125112         CDS       T01011                                 

Gene name
padi2
Definition
peptidyl arginine deiminase, type II (EC:3.5.3.15)
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     100125112 (padi2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 658 aa AA seqDB search
MQQNRTVRLVRGQRLEAVCVLGTTVSIPVLGGAPAESQWFSLHHSQNIEASVLRTDSAKQ
KTVNGEKLWPLTPESLVEIKMLAPSAETNDGKITFAYYGNGSDAPIDKAGVYFTGVEISL
DVDADRDGVVEKNNPHKASWTWGPNGQGAILLVNCDKDSLFARSVDGGDNIMMSKEDLLD
MSPMCLRVRGPEKLPTGYYLLLYVSASDAGNLGVFHYHNKIYSHVLGKQKLFYKARYTGT
NELQFFVEGLRFPDEGFEGLLSLRVSLLESMGEGIPDTPIFTDVVTFRMAPLIITPNTLQ
PIDVFVCSVKDNLFFLKAIKSLVAQADYNVKICFEDVNRGDRWMQDEIEFGYIHAPHKSF
PVVLDSPRDRGLKDFPVRNLLGPDFGYVTKLAAAAEVTSLDSFGNLEVSPPVTVNGKDYP
LGRILIGSSFPTSSGRRMTKAVRDFLYAQRVQAPVELYSDWLYVGHIDEFMTFVPTADKK
GFRLLLASPVACFQLFRQKKDEGHGDVTLFQGKETKRWTVAKIISTDSLVKENLYVQRSI
DWNRDILKQQLGLSEDDIIDIPALFKLESGGRALAFFPNMVNMLVLGKELGIPKPYGPVI
KESCCLEDHMVSLMKPLELNCTFIEDFTSYHNKLGEVHCGTNVRRKPFPFQWWRMEEP
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagaatcgcacggtgcgtttggtccgggggcagagactggaggctgtgtgtgtg
ttgggcaccaccgtatccatccctgtgctggggggggcgccagctgagtcccaatggttc
tccctgcaccactcgcagaacatcgaggcctccgtgctccgcaccgacagcgccaaacag
aaaactgtcaatggggagaagctttggccgctgacgccggagagtttggtggaaataaag
atgttggcgccgagcgcagagaccaacgatgggaagatcacatttgcatattatggcaac
gggtcagacgctcctatagacaaggctggagtctatttcactggggttgagatctcattg
gacgttgacgcagaccgcgatggggtcgtggagaagaacaatccgcacaaggcctcgtgg
acgtggggccctaacggacaaggggccattctcctagtgaactgcgacaaggacagccta
ttcgctcgctcggtggacgggggggacaatataatgatgagcaaagaagatctgctggac
atgtcccccatgtgtctccgggttcgggggcccgagaagctccccaccgggtattacctg
ctgctctatgtctccgcctccgacgcggggaatctgggggtgtttcactaccacaataag
atctatagccacgtgctgggcaagcagaagctgttctacaaggcgcgctacacgggaacc
aatgagctgcagttctttgtcgagggcctgcgcttcccggacgaggggttcgaggggctc
ctgtcactcagggtcagcctcctggagtccatgggggaggggatccctgacacccccata
ttcacagatgtggtcaccttccgtatggctcctctcatcatcaccccaaacacattgcag
cccatcgacgtgtttgtatgcagcgtcaaggacaacctcttcttcctaaaggccatcaag
agcctcgttgcccaggccgactacaacgtcaagatctgctttgaggatgtgaaccgggga
gaccgctggatgcaggatgagattgagttcgggtacatccacgccccccacaagagcttc
cctgtggttctggactcgccgcgagaccgggggctgaaggatttccctgtccggaatctg
ctgggcccggacttcggatacgtcactaaactcgccgccgctgccgaagtgaccagtctg
gactcatttgggaacctggaagtgagccccccagtaactgtgaatgggaaggattacccc
ctggggcgcattctgattggaagcagcttccccacctcctctgggcggcggatgaccaaa
gcagtacgagactttctctatgcccagcgggtacaggcgccagtagagctgtacagtgat
tggctgtatgtgggtcacattgatgagttcatgacctttgtacccacggccgataagaag
ggattccggcttctcttggccagtccggtcgcttgttttcagcttttccgtcagaagaag
gacgaggggcacggggacgtaacgttgtttcaggggaaggaaaccaagagatggacagtt
gccaagatcatctccactgattcgctggtgaaggagaacctttatgtccagcgatccata
gactggaacagggacatcctgaaacagcagctcggcctcagcgaagacgacatcattgat
atcccggcgctgttcaagttggagagcgggggccgagcgctggcattcttccccaatatg
gtgaatatgttggtgctggggaaggagctggggatccccaaaccctacgggccggtgatt
aaggagagctgctgcctggaggatcacatggtgtcgctgatgaagccgctcgagttgaac
tgcacgtttatcgaggactttacctcgtaccacaacaagttgggggaggtgcattgcggc
acaaacgtgcgtcggaagccgttcccgttccagtggtggcggatggaggagccgtaa

DBGET integrated database retrieval system