KEGG   Xenopus tropicalis (western clawed frog): 100125152Help
Entry
100125152         CDS       T01011                                 

Gene name
tyr
Definition
tyrosinase (EC:1.14.18.1)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Melanogenesis
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:xtr00350]
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:xtr00740]
Organismal Systems; Endocrine system; Melanogenesis [PATH:xtr04916]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 531 aa AA seqDB search
MERNMVPLAFCCLFFFLHVCRGQFPRACSTAESLLSKECCPVWSGDGSSCGQLSGRGVCQ
DVVLTSSATGPQFPFTGVDDRENWPTVFYNRTCQCLGNFMGYNCADCKFGFRGPNCTERR
TMIRKEIFRMSSAEKSKFVAYLNLAKHTTSRDYVIVTGTYAQMNNGSNPMFADINVYDLF
VWMHYYASRDVFIGEDALWRDIDFAHEAPAFVPWHRYFLLHWEHEIQKLTGDENFTIPFW
DWRDAQGCDICTDELLGGVHPTTTSLLSPASFFASWQIVCSRPEEYNAQRILCNGTGEGP
LFRNPGGHDRSRTPRLPTTAEVELCLSLTNYETEPMDRSANFSFRNTLEGFADPRTGIAN
RSQSNMHNSLHVFLNGSMSSVQGSANDPVFVLHHAFVDSIFEQWLRRHGASVDIYPEANA
PIGHNRGYYMVPFIPLYTNGEFFAASRDLGYDYDYLAESGSIEDFLLPYLEQARQIWQWL
VGAAVVGGLITAVIATIVGLACRRKRKFPSEETQPLLMEAEDYQPTYQSHL
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggaaaggaacatggtccctctggcattctgctgcctgttcttcttcctccatgtttgc
aggggccagttcccaagggcatgtagcaccgcagagtcgctcctgagcaaggagtgttgc
cctgtgtggtctggagatgggtcctcttgtggccagctatcaggaaggggtgtctgccag
gatgttgtcctgaccagctctgctactggccctcagtttccattcactggggttgacgat
agagagaactggccaacagtattttacaacaggacgtgccaatgccttggcaacttcatg
ggctataactgtgcagactgcaaatttggcttcagagggccaaactgcacagagagaaga
acaatgataagaaaggagatattccgaatgagcagtgctgagaagagcaaattcgttgcc
tacttgaatttggctaagcacaccaccagccgtgactatgtcatagtcactggcacctac
gcccagatgaataatggctccaaccctatgtttgcggatatcaacgtgtatgacctcttt
gtctggatgcattactatgcctcccgtgatgtcttcataggagaagatgctctctggaga
gacattgactttgcccatgaagctccggcttttgtgccctggcacaggtacttcctgctg
cactgggaacatgagattcagaaactcacaggagatgagaattttaccatccctttctgg
gattggagagatgcccaaggttgtgacatatgtacggatgagcttctgggaggggtccat
cccaccaccaccagcctattaagcccggcatccttcttcgcttcatggcagatagtatgc
agccgccctgaggaatacaatgctcagaggatcctatgcaatggtaccggggaagggccc
ctgttcagaaatcctggtggccacgatcggagcagaaccccccgattgcctacaacagct
gaagttgagctgtgtctgtcattaacaaattacgaaacggagcccatggatcggtcggcc
aactttagcttcaggaacaccctagaaggatttgcagatccacgaactgggatagccaac
cgctctcaaagcaacatgcataactcgctgcatgtgttcctcaacggctccatgtcttcc
gtccaaggatcggccaatgacccagtttttgtcttgcaccatgcttttgtcgacagcatc
tttgagcaatggctcagaagacacggagcttcagtagacatttacccagaagccaatgca
ccaattggccacaatcgtggctactacatggttccatttattcctctatacacaaatgga
gaattctttgccgcttctagagatcttggatatgattacgattatctagcagaatcaggt
tccattgaagacttccttttgccctacctggagcaagcgcgacaaatctggcagtggctg
gtaggcgcggctgtagttgggggactcattactgctgtgattgccactattgtcggcttg
gcgtgccgacggaaaagaaaattcccatcggaggaaacgcagccgctgctcatggaagcc
gaagattatcaacccacctatcagtctcacctatag

DBGET integrated database retrieval system