KEGG   Xenopus tropicalis (western clawed frog): 100125152Help
Entry
100125152         CDS       T01011                                 

Gene name
tyr
Definition
tyrosinase (EC:1.14.18.1)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Melanogenesis
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    100125152 (tyr)
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    100125152 (tyr)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    100125152 (tyr)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     100125152 (tyr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 531 aa AA seqDB search
MERNMVPLAFCCLFFFLHVCRGQFPRACSTAESLLSKECCPVWSGDGSSCGQLSGRGVCQ
DVVLTSSATGPQFPFTGVDDRENWPTVFYNRTCQCLGNFMGYNCADCKFGFRGPNCTERR
TMIRKEIFRMSSAEKSKFVAYLNLAKHTTSRDYVIVTGTYAQMNNGSNPMFADINVYDLF
VWMHYYASRDVFIGEDALWRDIDFAHEAPAFVPWHRYFLLHWEHEIQKLTGDENFTIPFW
DWRDAQGCDICTDELLGGVHPTTTSLLSPASFFASWQIVCSRPEEYNAQRILCNGTGEGP
LFRNPGGHDRSRTPRLPTTAEVELCLSLTNYETEPMDRSANFSFRNTLEGFADPRTGIAN
RSQSNMHNSLHVFLNGSMSSVQGSANDPVFVLHHAFVDSIFEQWLRRHGASVDIYPEANA
PIGHNRGYYMVPFIPLYTNGEFFAASRDLGYDYDYLAESGSIEDFLLPYLEQARQIWQWL
VGAAVVGGLITAVIATIVGLACRRKRKFPSEETQPLLMEAEDYQPTYQSHL
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggaaaggaacatggtccctctggcattctgctgcctgttcttcttcctccatgtttgc
aggggccagttcccaagggcatgtagcaccgcagagtcgctcctgagcaaggagtgttgc
cctgtgtggtctggagatgggtcctcttgtggccagctatcaggaaggggtgtctgccag
gatgttgtcctgaccagctctgctactggccctcagtttccattcactggggttgacgat
agagagaactggccaacagtattttacaacaggacgtgccaatgccttggcaacttcatg
ggctataactgtgcagactgcaaatttggcttcagagggccaaactgcacagagagaaga
acaatgataagaaaggagatattccgaatgagcagtgctgagaagagcaaattcgttgcc
tacttgaatttggctaagcacaccaccagccgtgactatgtcatagtcactggcacctac
gcccagatgaataatggctccaaccctatgtttgcggatatcaacgtgtatgacctcttt
gtctggatgcattactatgcctcccgtgatgtcttcataggagaagatgctctctggaga
gacattgactttgcccatgaagctccggcttttgtgccctggcacaggtacttcctgctg
cactgggaacatgagattcagaaactcacaggagatgagaattttaccatccctttctgg
gattggagagatgcccaaggttgtgacatatgtacggatgagcttctgggaggggtccat
cccaccaccaccagcctattaagcccggcatccttcttcgcttcatggcagatagtatgc
agccgccctgaggaatacaatgctcagaggatcctatgcaatggtaccggggaagggccc
ctgttcagaaatcctggtggccacgatcggagcagaaccccccgattgcctacaacagct
gaagttgagctgtgtctgtcattaacaaattacgaaacggagcccatggatcggtcggcc
aactttagcttcaggaacaccctagaaggatttgcagatccacgaactgggatagccaac
cgctctcaaagcaacatgcataactcgctgcatgtgttcctcaacggctccatgtcttcc
gtccaaggatcggccaatgacccagtttttgtcttgcaccatgcttttgtcgacagcatc
tttgagcaatggctcagaagacacggagcttcagtagacatttacccagaagccaatgca
ccaattggccacaatcgtggctactacatggttccatttattcctctatacacaaatgga
gaattctttgccgcttctagagatcttggatatgattacgattatctagcagaatcaggt
tccattgaagacttccttttgccctacctggagcaagcgcgacaaatctggcagtggctg
gtaggcgcggctgtagttgggggactcattactgctgtgattgccactattgtcggcttg
gcgtgccgacggaaaagaaaattcccatcggaggaaacgcagccgctgctcatggaagcc
gaagattatcaacccacctatcagtctcacctatag

DBGET integrated database retrieval system