KEGG   Xenopus tropicalis (western clawed frog): 100125173Help
Entry
100125173         CDS       T01011                                 

Gene name
g6pc2, igrp
Definition
glucose-6-phosphatase, catalytic, 2 (EC:3.1.3.9)
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100125173 (g6pc2)
   00052 Galactose metabolism
    100125173 (g6pc2)
   00500 Starch and sucrose metabolism
    100125173 (g6pc2)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100125173 (g6pc2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100125173 (g6pc2)
   04920 Adipocytokine signaling pathway
    100125173 (g6pc2)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     100125173 (g6pc2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 357 aa AA seqDB search
MENGMDALHDSGVQMIQYLQMNYKSSQDWFMFVSFAADLRNTFFIFFPIWFHLCEAVGIK
LIWVAVIGDWLNLVFKWILFGQRPYWWVHDTAYYGNSSAPAIEQFPVTCETGPGSPSGHA
MGSAGIYYVMVTAIITLMLKKKQTSLTNRCVCGALWAGFWAVQVCVCLSRIFLAAHFPHQ
VVAGVISGIVVAEAFHHTQLIYKASLKKYIYTTLFLFSFALGFYLLLKAVGVDLLWTLEK
AKRWCARPEWIHIDTTPFAGLLRNLGIFLGLGLALNSKLYQESCRGKKGSQFTFRLCCIV
ASLLVLHLFDSFKPPTKVEMLFYALSFCKSAAVPLAAVGIIPYCVSQVLHQQNKKSL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggagaacgggatggatgctctccatgactctggagttcagatgatccaatatctccag
atgaactacaagagttcccaagattggttcatgtttgtttcatttgccgctgatctcaga
aatacttttttcatcttctttcccatctggttccatctctgtgaggcagtgggcattaag
cttatttgggtggctgttatcggtgactggctgaatttggtctttaaatggattctcttt
ggacaaaggccatactggtgggtccatgacacagcttactatggaaactcatctgcacca
gctattgaacagtttcctgtcacctgtgagactggtccaggaagcccttcaggtcatgcc
atgggctcagctggtatttactatgttatggtcacagccattatcacattaatgctgaag
aagaagcaaacctcactcacaaaccggtgtgtgtgtggagctctctgggctggtttctgg
gctgttcaagtatgtgtctgcctttctagaatctttcttgcagctcattttcctcatcaa
gtggtagctggagttatttcaggaatagtagttgctgaagcttttcatcacacacagttg
atttataaggcgagcctgaagaaatacatctacaccacactcttcctgttctcctttgcc
ctgggcttctacttgcttcttaaagctgtaggagttgatctcctctggaccctggaaaaa
gccaagagatggtgtgctcgaccggagtggatacacattgacacaacaccctttgctggt
cttttaagaaaccttggtattttccttggccttggcctggcccttaactcaaagctgtat
caagaaagttgccgtggaaagaagggcagtcagtttactttccgcctctgctgcattgtt
gcctctttgcttgttcttcacctttttgattccttcaagccaccaaccaaagtggagatg
cttttctatgccttgtccttctgtaaaagtgctgctgtgcctcttgccgctgtaggaatt
attccttattgtgtttctcaagttcttcaccaacagaacaagaaatcactttag

DBGET integrated database retrieval system