KEGG   Xenopus tropicalis (western clawed frog): 100127189Help
Entry
100127189         CDS       T01011                                 

Gene name
ncoa1, Xsrc1, bhlhe42, bhlhe74, f-src-1, kat13a, ncoa-1, rip160, src-1, src1
Definition
nuclear receptor coactivator 1 (EC:2.3.1.48)
Orthology
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100127189 (ncoa1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 1503 aa AA seqDB search
MSGLGDSSADPASQDRKRKALPCDTAQSTEKRRREQENKYLEELAELLSANIGDIDSLSV
KPDKCKILIKRMDQIQQLKKKKQEKALGADDDVQKSDISSSSGGVIEKESLGPLLLEALD
GFFFVVNQEGRIVFVSENVTNYLGYKQEELMKDSIYSILHVGDHEEFVKNLLPKSLVNGV
PWSQEASRRNSHTLNCRMLIRPPDDAGVENQEARQRYEVMQCFTVSQPKSFKEEGEDFQS
CLICIARRLPRPAPITSLESFITKQDATGKIISIDTSSLRASGSLGWEDLVRKCIYAFFQ
AQGTEPSYAKQLFQEVMTRGTACSPSYKFTLSDGTELSAHTKCKLCYPQSPDVQPYIMGI
HIIERDQSSLCTQENTNSGMSLPRLSPSVNLTITPTQGMPFSSTTSPSSGGMLSSGINQH
QVAGLHNSNSSNTSQANFGCSPGSQIGTNVALSLGQAGPQNSNNLNLNNSPMSSPGISPP
QFMSPRPRASPGLVSRSRASGNPFSPPMPAMHSPVGISNSICNNNNNRPFSNVPLNSMPV
VNDPNTPLGFSTPSPGMTNNVSTTNNGRLFSNTPMNTVQGINEGPNPTVGYSTTSPVLRQ
LNSQNSPGRLNMQPIKMEPKDNSGNSDRTVEGETKPSLATSSNKLVQLLATTAEQQLRDV
DTNCRDPLTCHVVTNTSCGSSSSGTCPSSHSSLTERHKILHRLLQEGSPSDISSLSIDHE
KKNTGSANNQTPGGPPEVKMESESDKKKDSKDHQLLRYLLDKDEKEVKSSSALTLEDVKV
KVEKEQVDQCSSTPTTLIKAGQEDIKLETQNQFADDFDQLDQLLPTLDKAAQLPGMVPDR
TDNSVPLKTEMLPSSLQTGTVARTPTRLNNFNGMNTNQSPFGFCDPMDPVQLDLNPFPAP
SDTSPRSGLTPDQGRGVTHDATAFQSDPGLPDPDLGITEPQFGQPGIGDQIPWNDGLAPM
NRVTQSAQEEIDDFLCPPTTAEGRNDEKALLEQLVSFLSGKDENELAELDRALGIDKLVQ
GGGLDVVNDRFPQQSIAPVIMEQKPGLYPQQYPSASPNPGLPFFNMVRQKAAFGSVPVQV
QPPQARGTYPNTMGMQPRQALARSVTTSNQLRLQLQQRLQGQQQVLHQNRQANLNQFGVV
NTVAMGMRPGMQQAISTQQPPLNAQMLAQRQRELYSQQHRQRQLMQQRSILMRQQGFGNN
LAPAGSLPVTMGAGRLPQGPPQQFPYPHSYGTNPGNPPPSTSPFSPLATTPEATLANRGG
GNGNGIVNRGMMGNVGGQFGSGINPQMQQNVFQYSATGISQQGDPTFAPSLSPTSPLMSP
RITPSQSPMLQQTPSTPGYQSPDLKTWQQSPLGNSGVFSQGGQTQPPPGQQGMYNNMSIT
VSMGGGNTGVQNVNQMTGQMQMSSLPMSNMNAMCTEQQVSDPALRPSGLYCNQLSSTDLL
KTEPETGQVQQVQVFADVQCTVNLVGGDPYINQPGSITSQKATTGPQTPQAQQKSLLQQL
LTE
NT seq 4512 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcctcggggacagttccgcagatcctgctagccaggaccgcaagaggaaggcc
ttgccatgtgatacagcacagagcactgagaagcgccgccgggagcaggagaacaaatac
ctggaggagctcgccgagctgctgtcggccaatattggggatatagacagtctgagcgtc
aaaccggacaaatgcaagatcctcatcaagagaatggaccagatccaacagctgaagaag
aagaagcaagagaaagctttgggagcagacgatgatgtacagaaatccgacatctcatcc
agcagcggaggagtgattgagaaggagtccctggggcctctactgttagaggccctcgat
ggattcttctttgtcgtcaaccaggaaggcagaattgtctttgtgtcagaaaacgtcaca
aactacctgggctacaagcaagaggagctgatgaaggacagtatctatagcatcctacat
gtgggtgaccacgaggagtttgtgaaaaacctcctccccaagtctctagtgaatggggtt
ccctggtcccaagaggccagccgaaggaacagccacacgttgaactgcaggatgctgatt
cggcctccggatgacgccggggtggagaaccaagaagcccggcaacggtacgaagtgatg
cagtgctttactgtttcccaacccaaatccttcaaagaagaaggagaagatttccagtcc
tgtttgatctgcattgcgcggagattacctcgaccggcacccatcacctctttagaatcg
ttcatcaccaagcaggatgctacaggaaaaatcatctccattgacaccagttccctgcga
gcctcgggcagcctgggctgggaagatctggtgcggaagtgtatctatgccttctttcag
gcacagggcacagaaccgtcgtatgccaagcagctattccaggaagtgatgacacgagga
acagcctgcagtccatcgtacaaattcacgctgagtgacgggacggagctcagtgctcac
accaagtgcaaactgtgctatccgcagagccccgacgtgcagccctacataatgggaatc
catatcattgaaagggatcaaagctctctttgtactcaagaaaacactaactcaggaatg
tcactaccccgcctcagcccttcggttaacctcaccatcaccccaactcaagggatgccc
ttttcttcaacaacctccccgtccagtggtggcatgctcagctccgggataaaccagcac
caagtcgccggccttcataacagcaacagctccaacaccagccaagcgaactttgggtgt
tctcctggaagtcagattggaaccaatgttgccttaagcctggggcaggctgggccccaa
aacagtaacaatctcaacctcaacaattcccccatgagtagccctggaataagcccccca
cagttcatgtctccaaggccacgggctagcccaggactggtttcccggtctcgggcatca
ggtaatcccttttctccccccatgcctgccatgcactccccagtaggtatttcaaacagc
atctgcaacaacaataacaacaggcctttttcaaatgtccccttgaattccatgcctgtg
gtaaatgaccccaacacccctttaggattttctactccctcccccggcatgacaaacaat
gtatccaccaccaacaatggcaggctcttttccaataccccaatgaacactgttcagggg
attaatgaaggacccaacccaactgttggatattccactacatcccctgtcctgcgtcag
ttgaactcacagaactccccggggcgtctcaatatgcagcccatcaaaatggagccgaag
gacaacagtggcaatagtgacaggactgttgagggggagactaaaccctctttggccacc
tcgagtaacaaacttgtacagctgttagcaacaacagcagagcagcagttgcgagatgtg
gacactaattgccgagaccctctaacttgccatgttgtcactaacacaagctgtggaagt
tcctcgagtggaacatgtccttcatctcatagctctttgacagaacgtcacaagatattg
catcggcttcttcaggaagggagcccttcagacattagtagcttatcaatagatcatgaa
aagaaaaacactggctccgccaacaaccaaactccaggaggtccgccagaggtcaaaatg
gagtccgagagcgacaaaaaaaaggactccaaagatcaccagctcttgcgctacctgttg
gacaaggatgagaaggaggtgaagtcgtcctctgctctgactctggaagatgtaaaagta
aaagtggaaaaggaacaggttgatcagtgcagctccactcctaccacattgatcaaagct
ggtcaagaggatattaaattagagacccaaaaccagtttgcagatgattttgaccaactc
gatcagttgttgcctacactggacaaagcagcccaactaccgggaatggtgcctgaccgg
acagacaacagtgtcccactaaagacggagatgttaccctcgtcactgcaaacaggcact
gtggcgagaacccccacccgattaaacaattttaatggaatgaacacaaaccaatccccg
tttggattctgtgaccctatggaccccgtgcagttggatttgaacccatttccagcacca
agtgacaccagcccacgttctggactaacaccggaccagggacgtggtgtaacgcatgac
gcaactgctttccaatctgatccaggcttgccagatcctgaccttggaatcaccgagccg
cagtttgggcagccaggaattggggaccagataccctggaacgatgggttggcgcccatg
aaccgcgttacccagagtgcacaggaagagattgacgactttctgtgcccccccaccacg
gccgagggacgcaatgacgagaaggctctgctggagcagctcgtctcctttctcagtggc
aaagacgagaacgagctggcggaactagaccgcgccttggggattgacaaactagtacag
ggaggaggtctggatgtggtaaatgatcggtttcctcagcaatccattgctcctgtcata
atggagcagaagccgggcctgtacccccagcaatatccttctgcttcacccaacccaggc
ctccccttcttcaacatggtcaggcagaaggctgcatttgggtctgtccctgtccaggta
caacctcctcaggcccgtggtacctaccccaataccatggggatgcagccccggcaggct
ctggcgcgctcagtaaccacgtccaaccagctacggctccagctgcagcagcgactacag
ggccagcagcaggttctgcaccagaatcggcaagccaacctgaaccagtttggagtagtc
aataccgtggccatgggcatgaggcctggcatgcagcaagccatttccacccagcagccc
ccgctcaatgctcagatgttggctcagcgacagagggaactgtacagccagcagcatcgc
cagaggcagttaatgcagcaacgaagcatcctcatgaggcaacagggctttgggaacaat
ctggcccctgcaggaagcctgcctgtcactatgggggccggccgactcccccagggcccc
ccacaacaattcccttatcctcacagctacggtacaaaccctggaaatcctcccccatcc
accagtcccttctcgcctttggcgacgactcccgaggccacgttagccaaccgcggcgga
ggaaatggcaatggcattgtgaacagaggcatgatgggaaacgtcggaggacagtttggc
tctgggatcaaccctcagatgcagcaaaatgtcttccagtattcggcaacgggtatcagc
cagcaaggtgatccaaccttcgctccatcactcagcccaaccagtccgctcatgtccccc
cgtattactccctctcagagccccatgcttcagcaaacgccatccacgcctgggtaccag
tcacctgacctcaagacgtggcagcagagtcccctgggcaattctggggtttttagccaa
gggggacagacgcagcccccgcctggccagcagggaatgtacaacaacatgagcatcaca
gtttctatgggagggggcaacactggtgtccagaatgtgaatcaaatgaccggacagatg
cagatgagttcccttcccatgtccaacatgaacgctatgtgcacagaacagcaggtgagt
gatccagcactgaggccaagtgggctgtactgcaaccagctttcctctacagacctgctg
aaaacagagccagagacgggccaggtgcagcaggtacaggtctttgccgacgtccagtgc
acggtgaatttggtgggcggtgacccctatattaaccaaccgggatccatcacctcacag
aaggcaacgaccggaccccagacgcctcaggctcagcaaaagagcctcttacagcaactg
ctgacggaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system