KEGG   Xenopus tropicalis (western clawed frog): 100127203Help
Entry
100127203         CDS       T01011                                 

Gene name
mgll, hu-k5, mgl
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Glycerolipid metabolism
Metabolic pathways
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100127203 (mgll)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100127203 (mgll)
Peptidases [BR:xtr01002]
 Serine Peptidases
  Family S33
   100127203 (mgll)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
UniProt: 
Position
4
AA seq 309 aa AA seqDB search
MPEGSAPAVSPQGVLYAELTHYINADGQHIFSRYWKPSGSPRALMFIVHGAGEHCCRYDD
LAQILTALNFVVFSHDHVGHGQSEGERMTVPDFHIFVRDVIQHLDLMKKQYPGLPLFMCG
HSMGGAIAILTADERPDDFSGLILISPLVLPNPQSATSFKVFAAKMLNYVLPNLSLGSID
PNFVSRNKKEVEAYTSDPLVYHGGMKVSFGVQLLNATSRVEKALPHFKVPLLLFHGTLDK
LCDIRGSHVMMDTIQSEEKTLKVYEGAFHALHKELPEVTSNVFQEIEGWLQQRLGGTGSS
NMVQQASST
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaggtagcgcccccgctgtcagtcctcagggggtcctgtatgcggaactgacc
cactacattaacgcagatgggcaacacattttctccagatactggaagccttcaggttct
ccccgggctctgatgtttattgtacacggtgctggggaacactgctgccgatacgatgac
ctggcacagattctaaccgctctgaactttgtggtcttttcccatgaccatgtcggccat
gggcagagtgagggggagcgaatgaccgtccctgatttccatatctttgtaagagacgtt
atacaacacttggacctcatgaagaaacaatacccgggcctgccgctttttatgtgtggc
cattctatgggaggagccattgccatcctgactgctgatgagagaccggatgacttttct
ggattaatcctaatatctcctttggtgttgcctaacccacaatctgcaacgtcattcaag
gtttttgcagctaaaatgctgaactacgtccttccaaacctttccctgggcagcattgat
ccaaatttcgtatctcgcaataagaaagaggttgaggcctatacgtcagacccactggtt
taccacggaggaatgaaggtttcctttggtgtgcagttgctaaatgctacgtctcgagtg
gagaaagctctcccgcactttaaggttccactcctgctgtttcatggaaccttggacaag
ttgtgtgatattcgtggctcccatgtgatgatggacacgatacaaagcgaggagaagaca
ctaaaggtatatgaaggagctttccatgctttgcacaaagagctgccagaggttacctct
aatgtattccaagagattgagggctggcttcagcaaagattggggggcacaggatccagc
aacatggtgcagcaagcctccagcacatag

DBGET integrated database retrieval system