KEGG   Xenopus tropicalis (western clawed frog): 100127705Help
Entry
100127705         CDS       T01011                                 

Gene name
chrm4
Definition
cholinergic receptor, muscarinic 4
Orthology
K04132  
muscarinic acetylcholine receptor M4
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Neuroactive ligand-receptor interaction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100127705 (chrm4)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100127705 (chrm4)
G protein-coupled receptors [BR:xtr04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Acetylcholine (muscarinic) [OT]
    100127705 (chrm4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 478 aa AA seqDB search
MENMTNATNQTLDKTTMAPGTYQTMEMIFIATVTGSLSLVTVVGNILVMLSIKVNRQLQT
VNNYFLFSLACADLIIGVFSMNLYSLYIIKGYWPLGPIVCDLWLALDYVVSNASVMNLLI
ISFDRYFCVTKPLTYPARRTTKMAGLMIAAAWLLSFVLWAPAILFWQFIVGERTVASGEC
YIQFLSNPVVTFGTAIAAFYLPVVIMTILYIHISLASRSRVRRHCTETRQEKKKPISSMK
SPLIKQTKNLPKQDPGDEAVKKENGVRNGKIEKSMTNLQTAEEKETSNESSSASLSHNPP
EKQPVSDASSGVVLAPTQNMPPLPSKVNVASKWSKIKIVTKQTGNECVTAIEIVPECAIP
LPQQANNRPGNVARKFASIARNQVRKKRQMAAREKKVTRTIFAILLAFIITWTPYNVMVL
INTFCQTCIPETVWYIGYWLCYVNSTINPACYALCNATFKKTFKHLLMCQYKSIGMAR
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatatgacaaacgccaccaaccagaccttggacaaaaccaccatggcccctgga
acgtaccagacaatggaaatgatctttatcgccaccgtaactggttccctcagtttggtc
actgtggtgggcaacatcttggtcatgctctccattaaagtcaaccggcagctacagaca
gtcaacaattacttcctgttcagcttggcctgcgctgaccttatcataggcgtgttctcc
atgaacctctactctctttacattataaagggttactggccgcttggacctattgtgtgt
gacctgtggctggcgctggactatgtggtgagcaacgcttctgtgatgaacctcctcatc
attagctttgataggtacttctgtgtcaccaaaccactgacttacccagcacgaagaacc
accaagatggcggggctgatgattgcagccgcttggcttctctccttcgtgctctgggca
cctgctattcttttctggcagttcattgtaggagagaggacggtggcaagtggggaatgt
tacattcagttccttagcaacccggtggtcacctttggtacagccatcgctgccttctac
cttccggtggtcattatgactattctttacatccacatatctcttgccagcaggagcaga
gtccgcaggcactgcactgaaacccgacaggagaaaaaaaagccaatcagctccatgaag
agccctctaattaagcaaacgaagaaccttcccaaacaagaccccggagatgaggcggtc
aaaaaagagaacggggtgaggaacggcaagattgagaagtcaatgaccaacctgcagaca
gctgaagaaaaagagacctccaatgaatccagttcagccagcctgtctcacaaccctccg
gagaagcagcctgtaagtgacgcctcttcaggggttgtcctggccccgacccagaacatg
ccaccgctgccctcaaaagtgaatgttgcttccaaatggtccaagatcaagatcgtcacc
aagcagactggcaatgaatgcgtgacggctattgagattgttccagaatgtgccattcct
ttgccccaacaggccaataacaggccgggcaacgttgctagaaagtttgccagcatcgcc
cgcaaccaggtgaggaaaaagaggcagatggcagccagggagaagaaggtgaccaggacc
attttcgctatcctactggctttcatcattacctggacaccatacaatgtcatggtcttg
atcaataccttttgccagacatgtatccctgaaaccgtttggtacattgggtattggctc
tgctatgtcaacagcacaataaacccagcctgctatgccctttgcaatgccaccttcaag
aagaccttcaaacacctcctcatgtgtcagtacaaaagcatcggcatggccagatag

  All links  
No link information was found.   
DBGET integrated database retrieval system