KEGG   Xenopus tropicalis (western clawed frog): 100127737Help
Entry
100127737         CDS       T01011                                 

Gene name
aldh1l2
Definition
aldehyde dehydrogenase 1 family, member L2
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
One carbon pool by folate
Class
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:xtr00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 922 aa AA seqDB search
MLWTANQFIRKFSTTAIYYQNKLRLALIGQSLFGQEVYNNLRKEGHKIVGVFTVPDKDGK
ADPLAVAAEKDGTPVFKFPRWRVKGKSIPEVVEAYKSVGADLNVLPYCTQFIPMDVIDSP
KNGSIIYHPSILPRHRGASAINWTLINGDKKAGFSVFWADDGLDTGPILLQRACDVEPND
TVDTLYNRFLFPEGIKAMLEAVQLIADGKAPRIGQPEDGATYEGIQKKENAKICWDNSAQ
AIHNWIRGHDKVPGAWTLINEQMVTLYGSSLLDGPVPTGQPVSVEGASKPGLVTKNGLVL
FGNDGKMLTIRNLQFEDGKMIPASKYFSKDDSATLELTEQEKAVESEIRNIWKGILSNVS
VIENTTDFFKSGAASMDVVRLVEELKQKCEGLELQNEDVYMATTFEEFIQMVVRKLRGED
KEELVIDYASLNVNNMTVKMPYQCFINGQFADADNGKTYDTINPTDGSVICKVAYCSVAD
VDKAVAAAKDAFENGEWGKMNARDRGRILYRLADLMEEHQEELATIEAIDSGAVYTLALK
THVGMSVQTFRYFAGWCDKIQGSTIPINQARPNRNLTFTKKEPLGVCAIVIPWNYPLMML
AWKSAACLAAGNTLVLKPAQVTPLTALKFAELAVKAGVPKGVINILPGSGGLVGQRLSEH
PDIRKLGFTGSTPIGKQIMKSCAVSNLKKVSLELGGKSPLIIFNDCDLDKAVRMGMGAVY
FNKGENCIAAGRLFVEESIHDEFVTRVVEEIKKMRIGDPLDRSTDHGPQNHRAHLEKLLE
YCEIGVKEGATLVYGGRKVPRPGFFMEPTVFTDVEDHMYLAEEESFGPIMVISKFKDGDI
DGVLRRANNTEYGLASGVFTKDISKAMYVSEKLDAGTVFINTYNKTDVAAPFGGFKQSGF
GKDLGEEALHEYLRTKAVTVEY
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggacggccaatcagttcataaggaagttctccaccaccgcaatttactatcaa
aacaagctaagattggccctcattggtcagagtctctttggtcaggaagtatataacaat
ctacgtaaggaaggacataaaattgttggagtatttacagtgccagacaaggatggaaaa
gctgaccctttggctgtggctgctgagaaagatggcaccccagtgtttaaatttcccagg
tggcgagtgaagggcaagtctatcccagaggtagtggaagcctacaagtctgtgggggct
gatctgaatgttcttccttactgcacacagtttattcctatggatgttattgatagtcct
aaaaatggctctattatctaccacccttctatccttccccgacacagaggagcttcggca
atcaattggacattaattaatggagataagaaggcaggattctcagttttctgggcagat
gatggcctggatacagggccaatcctgctgcaaagagcgtgtgatgtggaacccaatgac
acagtagataccctttataaccgttttcttttccctgaaggaattaaagctatgttggaa
gctgtacagttaattgctgatggcaaagcacctcgcataggccagccagaggatggggct
acatatgaaggaattcaaaagaaagagaatgcaaagatttgctgggacaactctgcacag
gcaatccataattggatcagaggacacgacaaagtgccaggagcctggacactgattaat
gagcagatggtgacactttatggatcctctttgctggatggtccagtgcccacaggtcag
ccggtgtctgttgaaggtgcttcaaagcctggccttgtcaccaaaaatggacttgttctg
tttggtaatgatggcaaaatgttaacaataagaaatctccagtttgaggatggtaaaatg
ataccagcatcaaagtacttttcaaaggacgattcagcgactctggagcttacagaacag
gaaaaggcagtggaatcagagatcaggaatatttggaaagggatattaagcaacgtctct
gtgattgaaaataccactgactttttcaaatcaggagctgcatcaatggatgttgtcagg
ctggttgaggagctcaagcagaaatgcgaaggactagagctgcagaatgaagatgtctac
atggccaccacatttgaggaattcattcagatggttgtaagaaaattaagaggagaagat
aaagaagaactagtgatagattatgcatcgcttaatgtcaacaacatgacagtgaagatg
ccttaccagtgtttcatcaatgggcagtttgctgatgcagataatgggaaaacatatgac
actatcaatccaactgatggatccgtgatatgcaaagttgcttactgttcagtagcagat
gttgataaagctgttgcagcagcaaaagatgcttttgagaatggcgaatggggaaaaatg
aacgcaagggacaggggcagaattttatatagacttgcagatctcatggaagaacatcag
gaggagttagcgacaattgaggccattgattcaggagctgtatataccctagcgctaaag
actcatgttggaatgtcagttcagaccttccgatactttgctggctggtgtgacaagatt
cagggatctacaattccaataaaccaagctcgtcccaaccgtaacctgacttttactaaa
aaggaacctcttggtgtgtgtgccattgtcattccgtggaactatcccctgatgatgctc
gcttggaagagtgctgcatgtttggctgcaggaaataccttagttttaaaacctgcccag
gtcactccactgacagcacttaagtttgcagagctggctgtgaaggctggtgtgccgaaa
ggcgttatcaatatcctgcctggatcaggaggtctagttggacagcgcttgtctgagcat
ccagatattcgtaagcttggatttacaggctctacaccaattggcaaacagatcatgaaa
agttgtgccgtcagcaacttgaaaaaggtttccttggagcttggtggtaaatctccactt
atcatatttaatgactgcgatctggacaaagctgtgagaatgggaatgggagcagtgtat
tttaacaaaggagagaactgtattgcagcgggtaggctctttgtggaagaatccatacat
gatgagtttgtgaccagagtggtggaagaaattaagaaaatgaggataggtgaccctctt
gatagatctacagatcatggcccacaaaaccacagagctcacttggagaagctgttagaa
tactgtgaaataggagtgaaagaaggagccacacttgtatatgggggcagaaaagtacca
aggccaggcttcttcatggaaccaactgtattcacagatgttgaagaccacatgtatctt
gctgaggaagaatcatttggacccatcatggtcatttctaagttcaaagacggagacatt
gatggagtgttgcgacgtgccaataatacggaatatggattagcctcaggcgtgttcaca
aaagacataagcaaggcaatgtatgtcagtgaaaagttggatgctgggacagtttttatt
aacacatacaataagacagatgttgcagcaccatttggaggcttcaagcaatctggtttc
ggcaaggacttgggtgaagaagctctacatgaatacctcagaacaaaagctgttaccgtg
gaatattaa

DBGET integrated database retrieval system