KEGG   Xenopus tropicalis (western clawed frog): 100127743Help
Entry
100127743         CDS       T01011                                 

Gene name
xrcc4
Definition
X-ray repair complementing defective repair in Chinese hamster cells 4
Orthology
K10886  
DNA-repair protein XRCC4
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Non-homologous end-joining
Class
Genetic Information Processing; Replication and repair; Non-homologous end-joining [PATH:xtr03450]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 337 aa AA seqDB search
MEKKIRKIYISSYPGTIYFLQISWKKDLGNGFAVALTDGKSAWTGEVFPEDVTQEAKDME
MERSNYVDELRKALIMTTLPANKYNFDLLEDEENPEIYHFTYEKKLKEVAFKLGSTKLKN
VQNPAHVIRELINYCLDCTSELYSRNEHLQKENERLQCDWNDMHAQLEKFVNGKEELERD
LYTRFTCVLNEKKAKIRSLKEKLLESQERLKQKSEETAPDDTLVAKEMKYDAFAGSTDEE
QESPAVASKTAAASRRRSLVSYIDDAPDVAPSRKRRQRGQKTFYTDEVANTSKAAKEETQ
RCNPVPAKAVGTTLSTEGTSSQTLINTPDPDDLFSDI
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaaaaataagaaaaatctacatatcatcatacccaggaacaatatattttctt
cagatttcctggaagaaagatttgggaaatggattcgcagtagcactcactgatggtaaa
tctgcctggactggtgaggtttttccagaagatgttacccaagaagcaaaagacatggag
atggagaggtcaaactatgttgacgaattaaggaaagctttgattatgacgactttacca
gcaaataaatataattttgatctgttagaagatgaagaaaatcctgaaatctatcatttt
acatatgagaagaaactaaaggaagttgcatttaagcttggatcaactaaactaaaaaat
gtccagaacccggcacatgtcatcagagagttgataaactattgcctggactgcacctct
gaattatatagcagaaatgaacacctgcagaaggaaaatgaaaggcttcagtgtgactgg
aatgacatgcacgcgcagctggaaaagtttgtgaatggcaaagaagaactggagcgagac
ctttatactcgatttacctgtgttcttaatgagaaaaaagctaaaatcagaagcctgaag
gaaaaactattagaatcacaagaaagactcaaacaaaaaagtgaagaaactgctcctgat
gatactcttgtggccaaggaaatgaagtatgatgcctttgctggctcaactgatgaggag
caggaaagccctgcagttgcctctaagactgctgcagcatcccggcgcagatcactcgtc
agttacattgatgatgcccctgatgttgcaccaagtagaaaacgaagacagaggggccaa
aagacgttctacacagatgaagtagctaatacttctaaagcagctaaagaagaaacacag
agatgtaatccagtcccagcaaaggccgttggcacaactctctcaacagaaggaacttct
tcccagacattgataaacactccagatccagatgatctcttcagtgacatatga

DBGET integrated database retrieval system