KEGG   Xenopus tropicalis (western clawed frog): 100127753Help
Entry
100127753         CDS       T01011                                 

Gene name
g6pc, g6pt, gsd1, gsd1a
Definition
glucose-6-phosphatase, catalytic subunit (EC:3.1.3.9)
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100127753 (g6pc)
   00052 Galactose metabolism
    100127753 (g6pc)
   00500 Starch and sucrose metabolism
    100127753 (g6pc)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100127753 (g6pc)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100127753 (g6pc)
   04920 Adipocytokine signaling pathway
    100127753 (g6pc)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     100127753 (g6pc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 356 aa AA seqDB search
METGMENLHSTGVHIVQYLQENFIKSQDWFVFVSFAADLKNTFLVLFPIWFHLSESVGIK
LVWVAVIGDWLNLVFKWILFGQRPYWWVHETTFFINSSAPTILQFPVTCETGPGSPSGHA
MGSSSVYYVMAHAVLSILLENKTSLMSRFQRWALWLFFWSVQVNVCLSRVFVAAHFPHQV
IAGVFSGMLVAEMFNHIQCIYNASFKRYLHATLFLFFFALGFFLLLKVFGVDLLWTLEKA
KRWCARPEWIHIDTTPFAGLLRNLGVFFGLGLALDTQMYRDSCRGKKSGQFTFRLCCIMI
SLLVLHLFDSLELPADKEILFYFLSFCRSVAVSLAVVAVIPYCISHALQWQKKKVT
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggagacaggaatggagaatcttcacagcactggggtccacattgtacagtacctccag
gagaactttataaagtcacaagactggtttgtttttgtctcttttgctgctgatcttaaa
aacacattcttagttttatttcccatctggttccacttgagcgagtcagtgggcatcaag
cttgtctgggtggctgttataggggattggctcaaccttgtcttcaagtggatccttttt
ggacagaggccatactggtgggtacatgaaacaacattcttcattaattcctcagctccc
accatccttcagttccctgtgacatgtgagactgggccaggaagcccctcaggacatgcc
atgggttcttcttctgtctactatgtgatggctcatgctgttctttccattcttcttgag
aataagacttccctcatgagccggtttcagcgttgggccttgtggctgtttttctggagc
gtgcaggtcaacgtctgtctgtcacgtgtatttgtggcagcacattttccccatcaagtt
attgctggtgtattttcaggcatgctggttgctgaaatgtttaaccatatccaatgtatc
tacaatgccagtttcaaaagatacctacatgcaacactttttctctttttctttgccctg
gggttctttctgcttctgaaagtttttggagtagaccttctgtggacactggagaaggcc
aagagatggtgtgcccggccagagtggatccacattgatactactccatttgctggcctc
cttagaaacctgggtgtcttctttggcctggggctggcacttgacactcaaatgtacagg
gacagctgtagagggaagaaaagtgggcagttcaccttccgcctttgttgcattatgatt
tctctgttggttctccatctcttcgactcgctggaacttcctgctgataaggagattctc
ttctactttctgtctttttgcagaagtgttgctgtttcccttgctgttgtggctgtcatc
ccgtactgcatatcccatgctctccagtggcaaaaaaagaaagttacatga

DBGET integrated database retrieval system