KEGG   Xenopus tropicalis (western clawed frog): 100127753Help
Entry
100127753         CDS       T01011                                 

Gene name
g6pc, g6pt, gsd1, gsd1a
Definition
glucose-6-phosphatase, catalytic subunit (EC:3.1.3.9)
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:xtr00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:xtr00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xtr00500]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:xtr04068]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:xtr04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:xtr04920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 356 aa AA seqDB search
METGMENLHSTGVHIVQYLQENFIKSQDWFVFVSFAADLKNTFLVLFPIWFHLSESVGIK
LVWVAVIGDWLNLVFKWILFGQRPYWWVHETTFFINSSAPTILQFPVTCETGPGSPSGHA
MGSSSVYYVMAHAVLSILLENKTSLMSRFQRWALWLFFWSVQVNVCLSRVFVAAHFPHQV
IAGVFSGMLVAEMFNHIQCIYNASFKRYLHATLFLFFFALGFFLLLKVFGVDLLWTLEKA
KRWCARPEWIHIDTTPFAGLLRNLGVFFGLGLALDTQMYRDSCRGKKSGQFTFRLCCIMI
SLLVLHLFDSLELPADKEILFYFLSFCRSVAVSLAVVAVIPYCISHALQWQKKKVT
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggagacaggaatggagaatcttcacagcactggggtccacattgtacagtacctccag
gagaactttataaagtcacaagactggtttgtttttgtctcttttgctgctgatcttaaa
aacacattcttagttttatttcccatctggttccacttgagcgagtcagtgggcatcaag
cttgtctgggtggctgttataggggattggctcaaccttgtcttcaagtggatccttttt
ggacagaggccatactggtgggtacatgaaacaacattcttcattaattcctcagctccc
accatccttcagttccctgtgacatgtgagactgggccaggaagcccctcaggacatgcc
atgggttcttcttctgtctactatgtgatggctcatgctgttctttccattcttcttgag
aataagacttccctcatgagccggtttcagcgttgggccttgtggctgtttttctggagc
gtgcaggtcaacgtctgtctgtcacgtgtatttgtggcagcacattttccccatcaagtt
attgctggtgtattttcaggcatgctggttgctgaaatgtttaaccatatccaatgtatc
tacaatgccagtttcaaaagatacctacatgcaacactttttctctttttctttgccctg
gggttctttctgcttctgaaagtttttggagtagaccttctgtggacactggagaaggcc
aagagatggtgtgcccggccagagtggatccacattgatactactccatttgctggcctc
cttagaaacctgggtgtcttctttggcctggggctggcacttgacactcaaatgtacagg
gacagctgtagagggaagaaaagtgggcagttcaccttccgcctttgttgcattatgatt
tctctgttggttctccatctcttcgactcgctggaacttcctgctgataaggagattctc
ttctactttctgtctttttgcagaagtgttgctgtttcccttgctgttgtggctgtcatc
ccgtactgcatatcccatgctctccagtggcaaaaaaagaaagttacatga

DBGET integrated database retrieval system