KEGG   Xenopus tropicalis (western clawed frog): 100127787Help
Entry
100127787         CDS       T01011                                 

Definition
uncharacterized LOC100127787
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Module
Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100127787
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    100127787
   00603 Glycosphingolipid biosynthesis - globo series
    100127787
   00604 Glycosphingolipid biosynthesis - ganglio series
    100127787
   00511 Other glycan degradation
    100127787
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100127787
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     100127787
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 532 aa AA seqDB search
MARIAHSPRLCCCLLSVVFVSQFVERVCGVWPLPQEIQQSAESSGLSPQLFTFTYSQDSA
AQAGCSVLDTAFKRYFSIIFPDFTKDALHDMWLEPKAFVVSVSVKTRGCDGYPDEDSDES
YNLSVSDGQAVLRSVTVWGALRGLESFSQLVYRDDYGAYFVNKTEIIDFPRFAFRGLLLD
TSRHYLPLHAILKTLDAMAYSKFNVFHWHIVDDPSFPYQSRTFPDLSKKGAFHPFTHIYT
QSDVMRVIEHARMRGIRVVPEFDSPGHTQSWGKGQPDLLTPCYKGSKPSGTYSPVDPTVD
TTYRFMERLLKEVKFVFPDSYVHLGGDEVSFACWQSNPSVGKFMEKMGFGRDFTKLESFY
MESIMNITAALNKTSIVWQDVFDYHERIPQGTVLEIWKGETYLTELSKMTKAGHRVLLSA
PWYINHITYGQDWRNSYAVQPQNFSGTEEQKKLVIGGEVAMWGEYVDATNLNPRLWPRAC
AAAERLWSNEEKTLNADLAFPRLEEFRCELVRRGIQAEPLFVGHCKHEFNGL
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggccaggatcgcacactctcctcgtctctgctgctgcctgctgtcagttgtgtttgtc
agtcagtttgtggagcgggtgtgtggagtttggccgttgcctcaggagatccaacagtct
gctgaaagctccgggctgagcccgcagctcttcactttcacatacagccaggactccgct
gcacaggcgggatgctccgtgctggacactgccttcaaaagatacttctccatcatattc
cccgactttactaaagatgcgcttcatgacatgtggttggagccaaaagccttcgttgtg
tcagtgagtgtcaaaaccagaggatgtgacggttaccctgacgaagattcagatgaaagc
tataacctgagtgtgtcagacggccaggctgtgctgagatcagtgactgtatggggcgct
ttgagaggtctggagtccttcagtcagcttgtgtaccgtgatgattatggcgcttatttt
gtcaacaagactgagatcatagacttcccacgttttgcatttcgaggacttttgttggac
acttctaggcattatttacccctccatgctatcttgaagaccttggatgccatggcatat
agtaaatttaatgtcttccactggcacattgtggacgacccttcctttccgtatcagagc
cgaacttttcctgacctcagtaaaaagggagcttttcatccatttactcatatctacaca
cagtcagatgtgatgagagtgattgaacatgccaggatgaggggtattagagtcgtgcct
gagtttgactcacctggacacactcaatcatggggaaaaggccagccagatctcttgacc
ccctgttataaaggcagtaagccttctggaacgtacagtcctgttgatccaacagtggac
accacctataggttcatggagcgtctcctgaaggaggtgaagttcgtctttccagactcg
tatgttcatttaggaggggatgaggtcagctttgcttgctggcagtccaatcccagtgta
ggaaagtttatggaaaagatgggatttgggagggattttacaaaactggagtcattctat
atggagagcataatgaacataacggccgctctcaacaaaacctccattgtttggcaggac
gtgtttgactaccatgaacgaattccacagggcacggttctggagatctggaagggtgaa
acttacctgaccgaactgagtaagatgaccaaggctgggcacagggttctgctctctgcc
ccctggtacataaaccacatcacctacggccaggactggcgcaactcctacgcagtgcag
ccgcagaatttctccgggacagaggagcagaaaaagttggtgattggtggagaggtcgcc
atgtggggagaatatgttgatgccaccaatctaaacccacgtctatggccaagagcttgt
gctgctgctgagagattgtggagcaatgaagaaaagactctgaatgcagatctggccttc
cctcgcctggaagagtttcgctgcgaacttgtaaggcgagggattcaagcggagcctctg
tttgtcggtcactgtaaacacgagtttaatggtctgtaa

DBGET integrated database retrieval system