KEGG   Xenopus tropicalis (western clawed frog): 100127862Help
Entry
100127862         CDS       T01011                                 

Gene name
lpl, hdlcq11, lipd
Definition
lipoprotein lipase
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:xtr00561]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:xtr03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 483 aa AA seqDB search
MSSGEFLTLFLWIHWLLTCCSGALATTEPSKTSPTTLKKTDFNSIESKFSLRTLEEPDDD
TCYLVPGQEHTVDQCNFNHTSKTFVVIHGWTVTGMFESWVPKLVDALYKREPDSNVIVVD
WLTRAQQHYPVSAEYTQLVGQDVASFIDWMDDTIQYPIDNIHILGYSLGAHAAGVAGSLT
NKKVNRITGLDPAGPTFEYAENAIILSPDDAEFVDVLHTYTRGSPDRSIGIQKPVGHIDI
YPNGGSFQPGCNLGEALRLIAEKGFGDVDQLVKCSHERSIHLFIDSLLYEEKPSMAYRCN
SKEAFEKGLCLSCRKNRCNTLGYKVNKVRGKRSTKMYLKTRAQMPFKVFHYQVKVHFFAK
KNLTVTDQPFLVSLYGTQGESVNMPITIPEISTNKTYSYLIYTELDIGDLLMLKIKWEKD
SYFSWSDWFTAYLFNIQKIRVKSGEFQKKLVFCSKEGNFASLQRGKEPVVFVKCNEHAKK
KQE
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtggggaattccttacactgtttttgtggatacactggctgctgacctgctgc
agtggagctttagcaactactgaaccttctaaaacaagtccaactacgttaaagaaaact
gactttaacagtattgagagcaaattttccctaagaactttagaagagccggatgatgac
acttgttatctagtacctggtcaagaacacacagtggatcaatgtaatttcaaccacaca
agcaaaacatttgttgtaatccatggatggacggttacaggcatgtttgagagttgggtt
cctaaactggtagatgccttgtacaaaagagagccagactccaatgtcattgttgttgac
tggctaactcgagcccaacaacactaccctgtctctgcagagtatactcagctggttgga
caagatgttgcaagtttcattgactggatggatgatacaatacaatatccaatagataac
attcatatcctgggatacagccttggggctcatgcagccggtgttgctggaagtctgaca
aataaaaaagtcaacaggataactggactggatcctgcaggccctacctttgaatatgca
gagaatgctattattttgtcccctgatgatgccgaatttgtggatgtcctccatacttac
actaggggctctccagaccgtagtattggtattcaaaagcctgtaggacatattgacatt
tatccaaatggtggaagctttcagcctggttgcaatctcggggaagccctccgacttatt
gcagaaaaaggatttggagatgtggaccagcttgtgaaatgttctcatgaacgctccatt
catctcttcattgattctctgttgtatgaagaaaagccaagcatggcctatcgctgcaat
tctaaagaagcctttgaaaaggggctttgcttgagctgcaggaaaaatcgttgcaataca
ctgggttataaggtcaacaaagttcggggaaaaagaagcaccaagatgtacttgaaaaca
agagctcagatgcctttcaaagttttccattaccaagttaaagtgcacttctttgcaaag
aagaacttgactgtaaccgatcaacctttcttagtttctttgtatggaacccaaggagaa
agtgtgaacatgcctatcacgatacctgaaatttctaccaacaagacttattcatacttg
atctacactgaattagatattggagatctactgatgttgaaaataaagtgggaaaaggac
tcctattttagttggtctgactggttcaccgcttatttatttaacatccaaaagatccga
gtaaaatccggagaattccagaaaaagttagttttctgctctaaagaaggcaattttgca
tcactgcagagagggaaggaaccagtagtatttgtgaaatgtaacgaacacgccaaaaaa
aagcaagaatga

DBGET integrated database retrieval system