KEGG   Xenopus tropicalis (western clawed frog): 100127862Help
Entry
100127862         CDS       T01011                                 

Gene name
lpl, hdlcq11, lipd
Definition
lipoprotein lipase
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100127862 (lpl)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100127862 (lpl)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     100127862 (lpl)
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100127862 (lpl)
  Exosomal proteins of breast milk
   100127862 (lpl)
Heparan sulfate/heparin binding proteins [BR:xtr00536]
 Enzymes (General comment) Variety
  100127862 (lpl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 483 aa AA seqDB search
MSSGEFLTLFLWIHWLLTCCSGALATTEPSKTSPTTLKKTDFNSIESKFSLRTLEEPDDD
TCYLVPGQEHTVDQCNFNHTSKTFVVIHGWTVTGMFESWVPKLVDALYKREPDSNVIVVD
WLTRAQQHYPVSAEYTQLVGQDVASFIDWMDDTIQYPIDNIHILGYSLGAHAAGVAGSLT
NKKVNRITGLDPAGPTFEYAENAIILSPDDAEFVDVLHTYTRGSPDRSIGIQKPVGHIDI
YPNGGSFQPGCNLGEALRLIAEKGFGDVDQLVKCSHERSIHLFIDSLLYEEKPSMAYRCN
SKEAFEKGLCLSCRKNRCNTLGYKVNKVRGKRSTKMYLKTRAQMPFKVFHYQVKVHFFAK
KNLTVTDQPFLVSLYGTQGESVNMPITIPEISTNKTYSYLIYTELDIGDLLMLKIKWEKD
SYFSWSDWFTAYLFNIQKIRVKSGEFQKKLVFCSKEGNFASLQRGKEPVVFVKCNEHAKK
KQE
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtggggaattccttacactgtttttgtggatacactggctgctgacctgctgc
agtggagctttagcaactactgaaccttctaaaacaagtccaactacgttaaagaaaact
gactttaacagtattgagagcaaattttccctaagaactttagaagagccggatgatgac
acttgttatctagtacctggtcaagaacacacagtggatcaatgtaatttcaaccacaca
agcaaaacatttgttgtaatccatggatggacggttacaggcatgtttgagagttgggtt
cctaaactggtagatgccttgtacaaaagagagccagactccaatgtcattgttgttgac
tggctaactcgagcccaacaacactaccctgtctctgcagagtatactcagctggttgga
caagatgttgcaagtttcattgactggatggatgatacaatacaatatccaatagataac
attcatatcctgggatacagccttggggctcatgcagccggtgttgctggaagtctgaca
aataaaaaagtcaacaggataactggactggatcctgcaggccctacctttgaatatgca
gagaatgctattattttgtcccctgatgatgccgaatttgtggatgtcctccatacttac
actaggggctctccagaccgtagtattggtattcaaaagcctgtaggacatattgacatt
tatccaaatggtggaagctttcagcctggttgcaatctcggggaagccctccgacttatt
gcagaaaaaggatttggagatgtggaccagcttgtgaaatgttctcatgaacgctccatt
catctcttcattgattctctgttgtatgaagaaaagccaagcatggcctatcgctgcaat
tctaaagaagcctttgaaaaggggctttgcttgagctgcaggaaaaatcgttgcaataca
ctgggttataaggtcaacaaagttcggggaaaaagaagcaccaagatgtacttgaaaaca
agagctcagatgcctttcaaagttttccattaccaagttaaagtgcacttctttgcaaag
aagaacttgactgtaaccgatcaacctttcttagtttctttgtatggaacccaaggagaa
agtgtgaacatgcctatcacgatacctgaaatttctaccaacaagacttattcatacttg
atctacactgaattagatattggagatctactgatgttgaaaataaagtgggaaaaggac
tcctattttagttggtctgactggttcaccgcttatttatttaacatccaaaagatccga
gtaaaatccggagaattccagaaaaagttagttttctgctctaaagaaggcaattttgca
tcactgcagagagggaaggaaccagtagtatttgtgaaatgtaacgaacacgccaaaaaa
aagcaagaatga

DBGET integrated database retrieval system