KEGG   Xenopus tropicalis (western clawed frog): 100127879Help
Entry
100127879         CDS       T01011                                 

Gene name
usp46
Definition
(RefSeq) ubiquitin specific peptidase 46
  KO
K11842  ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100127879 (usp46)
Peptidases [BR:xtr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100127879 (usp46)
Ubiquitin system [BR:xtr04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100127879 (usp46)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 Peptidase_C98 NapB DUF3800 CEBP_ZZ
Motif
Other DBs
NCBI-GeneID: 100127879
NCBI-ProteinID: NP_001106637
Xenbase: XB-GENE-5749343
UniProt: A9JTY0
Position
8
AA seq 369 aa AA seqDB search
MDVLMTVRKIASICTMGTNASTLEKEIGPEQFPVNEHYFGLVNFGNTCYCNSVLQALYFC
RPFREKVLAYKVQPRKKESLLTCLADLFNSIATQKKKVGVIPPKKFISRLRKENELFDNY
MQQDAHEFLNYLLNTIADLLLEERKQEKQNGKLQNGTLEAPEPEKSDLTWVHEIFQGTLT
NETRCLNCEAVSSKDEDFLDLSVDVEQNTSITHCLRGFSNTETLCSEYKYYCEQCRSKQE
AQKRMRVKKLPMILALHLKRFKYMDQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRMYD
LVAVVVHCGSGPNRGHYITIVKSHGFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSESG
YILFYQSRD
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggacgtactgatgaccgtccggaagatcgcctcgatctgtacgatgggcaccaatgcc
tcaacattggaaaaagaaataggcccagagcaatttcctgtaaatgaacattacttcggt
ttggtcaattttggaaacacctgttactgtaactctgttctacaagcactttatttttgt
cgtccgtttcgggagaaagttttggcgtacaaggtccagccgcggaagaaggaaagcttg
ctcacgtgcctggcagacctcttcaacagtattgccacgcaaaagaagaaagtgggggtc
attcctcccaagaaatttatctccaggctaagaaaggaaaatgaactttttgataactac
atgcaacaggatgcccatgaatttctgaactaccttctgaacactatagctgatttgctg
ctggaggagaggaagcaggagaagcagaatggcaaattacagaatgggaccctggaggcc
ccagagcctgaaaagtctgacctcacctgggtacatgagatcttccaaggaacactaacc
aatgaaacccgatgtcttaactgtgaagctgttagtagcaaagatgaagacttcctggat
ctctctgtagatgtggaacagaacacttctattacacattgcttaagggggttcagcaac
acagaaacactatgcagtgaatataaatattattgtgagcagtgtcgtagcaaacaggaa
gcacagaaaagaatgagagtaaagaagttgcctatgattctcgctctgcacttaaaaagg
tttaaatacatggaccagctgcatcgatataccaaactgtcctaccgagtggtgtttccg
ttggagctgcgactcttcaacacctcaggggacgctaccaacccagacagaatgtatgat
cttgtggcagtggtagttcactgtggaagtggaccaaatcgcggacactacattaccatt
gtaaaaagccatggattctggttgctgtttgacgatgatattgtggagaaaatcgatgcg
caagccattgaggaattctacggcttaacatctgacatttccaaaaactcagagtccggc
tatatcctgttctatcaatctagagactga

DBGET integrated database retrieval system