KEGG   Xenopus tropicalis (western clawed frog): 100127879Help
Entry
100127879         CDS       T01011                                 

Gene name
usp46
Definition
ubiquitin specific peptidase 46 (EC:3.1.2.15)
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100127879 (usp46)
Peptidases [BR:xtr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100127879 (usp46)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 369 aa AA seqDB search
MDVLMTVRKIASICTMGTNASTLEKEIGPEQFPVNEHYFGLVNFGNTCYCNSVLQALYFC
RPFREKVLAYKVQPRKKESLLTCLADLFNSIATQKKKVGVIPPKKFISRLRKENELFDNY
MQQDAHEFLNYLLNTIADLLLEERKQEKQNGKLQNGTLEAPEPEKSDLTWVHEIFQGTLT
NETRCLNCEAVSSKDEDFLDLSVDVEQNTSITHCLRGFSNTETLCSEYKYYCEQCRSKQE
AQKRMRVKKLPMILALHLKRFKYMDQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRMYD
LVAVVVHCGSGPNRGHYITIVKSHGFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSESG
YILFYQSRD
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggacgtactgatgaccgtccggaagatcgcctcgatctgtacgatgggcaccaatgcc
tcaacattggaaaaagaaataggcccagagcaatttcctgtaaatgaacattacttcggt
ttggtcaattttggaaacacctgttactgtaactctgttctacaagcactttatttttgt
cgtccgtttcgggagaaagttttggcgtacaaggtccagccgcggaagaaggaaagcttg
ctcacgtgcctggcagacctcttcaacagtattgccacgcaaaagaagaaagtgggggtc
attcctcccaagaaatttatctccaggctaagaaaggaaaatgaactttttgataactac
atgcaacaggatgcccatgaatttctgaactaccttctgaacactatagctgatttgctg
ctggaggagaggaagcaggagaagcagaatggcaaattacagaatgggaccctggaggcc
ccagagcctgaaaagtctgacctcacctgggtacatgagatcttccaaggaacactaacc
aatgaaacccgatgtcttaactgtgaagctgttagtagcaaagatgaagacttcctggat
ctctctgtagatgtggaacagaacacttctattacacattgcttaagggggttcagcaac
acagaaacactatgcagtgaatataaatattattgtgagcagtgtcgtagcaaacaggaa
gcacagaaaagaatgagagtaaagaagttgcctatgattctcgctctgcacttaaaaagg
tttaaatacatggaccagctgcatcgatataccaaactgtcctaccgagtggtgtttccg
ttggagctgcgactcttcaacacctcaggggacgctaccaacccagacagaatgtatgat
cttgtggcagtggtagttcactgtggaagtggaccaaatcgcggacactacattaccatt
gtaaaaagccatggattctggttgctgtttgacgatgatattgtggagaaaatcgatgcg
caagccattgaggaattctacggcttaacatctgacatttccaaaaactcagagtccggc
tatatcctgttctatcaatctagagactga

DBGET integrated database retrieval system