KEGG   Xenopus tropicalis (western clawed frog): 100135009Help
Entry
100135009         CDS       T01011                                 

Gene name
pdk3
Definition
pyruvate dehydrogenase kinase, isozyme 3 (EC:2.7.11.2)
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     100135009 (pdk3)
Protein kinases [BR:xtr01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [Table]
   100135009 (pdk3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 405 aa AA seqDB search
MRLCRFLLKNTVPSQIEYYSKFSPSPLSIKQFLDFGRNNACEKTSYLFLRKELPVRIANS
LKEVNLLPESLLQRPSVKLVRSWYLQSFLELLEYENKSPEDSDVLYDFLNVLIQVRNRHN
DVVPTMAQGVIEYKEKYGFDPFVSSNIQYFLDRFYMNRISFRMLINQHTLLFGGDINPAH
PKHIGSIDPTCNVPEVVKDAYETAKMLCEQYYMAAPELKIEEFNAKAPGRPLHVVYVPSH
LFHMLFELFKNSMRATVELHEGKTDALPPVKALVTLGKEDLSIRISDKGGGVPLRKIDRL
FNYMYSTAPRPSLEPSRAVPLAGFGYGLPISRLYARYFQGDLKLYSMEGVGTDAVIYLKA
VSSESFERLPVFNKSAWRHYKNAAEADDWSNPSREPRDASKYKSN
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgtgcaggttcctgctgaagaacacagtccccagtcagatcgagtactactcc
aaattctccccctctccgctctccatcaaacagttcctggattttgggcgtaataatgct
tgtgagaagacatcttacctgtttctaaggaaagaactgccagtgcgaattgcaaatagt
ctcaaagaggtaaacctgctgcctgagagtttgctgcagagaccgtctgtgaaactagtg
cgatcctggtacttgcagagttttctagaacttttagaatatgaaaataagagcccagaa
gattcagatgtgctgtatgactttttaaatgtactcatccaagtgagaaataggcacaat
gacgtggttcctacaatggcccaaggcgtcatagaatataaggagaaatatggatttgac
ccatttgtcagcagcaacattcagtactttctggatcgattctacatgaatagaatttct
ttccgaatgctcatcaatcagcacactctgctctttggaggggacataaaccccgctcat
ccaaaacacataggcagcattgatcctacctgtaatgtaccagaagtggttaaagatgct
tatgaaacagcaaagatgctgtgtgagcagtattacatggcagctcctgagctgaaaatt
gaagagtttaatgccaaggctcctggcaggcctctccatgttgtttatgtgccctcccat
ctgtttcatatgctgtttgagctatttaagaactcaatgagagccaccgtcgagctccac
gaaggcaaaactgatgccttgcccccagtaaaggcactggtcacactgggaaaagaagat
ctgtctataaggataagtgataaaggtggcggggtgcccttgaggaaaattgatcgtctc
tttaattacatgtattcaacagcaccaagaccaagcctggaaccaagcagggcagttcca
ctggctggatttggctatggcctgcccatctcacgactatatgcccgatatttccaagga
gacctcaagctctattccatggaaggtgttgggactgatgctgttatctatcttaaggcc
gtttccagcgaatcatttgaaaggctcccggtttttaacaagtcagcgtggcgacactat
aagaacgcagccgaagcagatgactggagcaatccaagcagggagccacgggatgcttcc
aaatacaaatctaattaa

DBGET integrated database retrieval system