KEGG   Xenopus tropicalis (western clawed frog): 100135013Help
Entry
100135013         CDS       T01011                                 

Gene name
map2k4, jnkk, jnkk1, mapkk4, mek4, mkk4, prkmk4, sek1, serk1, xmek2
Definition
mitogen-activated protein kinase kinase 4 (EC:2.7.1.-)
Orthology
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Toll-like receptor signaling pathway
GnRH signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:xtr04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:xtr04012]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:xtr04620]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:xtr04912]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 398 aa AA seqDB search
MQGKRKALKLNFANPAFKSTAKFTLNPTIPSTHMMHKLDAIRNLETTYPKQDLRTSGGKA
LSTNEQATKNRLERLRTHSIESSGKLKLSPEQHWDFTAEDLKDLGEIGRGAYGSVNKMSH
TPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELM
ATSFDKFYKYVYSSLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDTNG
NIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELA
TGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFISFVNQCLTKDESKRPKYKEL
LKHPFILMYEERTVEVAGYVGKILEQMPASPSSPMYVD
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcagggtaaacgtaaagcactgaagttgaattttgccaacccggccttcaaatcgaca
gcaaaattcaccctgaaccccactattccaagtacccacatgatgcacaaactggacgct
atcagaaatcttgagacgacgtacccaaaacaggatttgcggacatctggcgggaaggcg
ttaagcacaaatgaacaggcaacaaaaaaccggctagagagactgaggacgcacagtatt
gaatcatctggaaaattaaagctctctccagaacaacattgggacttcacagcagaagac
ttaaaggacctgggggagattggccgcggtgcttacggctctgtcaataaaatgagccat
acccctagcgggcagattatggctgttaagaggattcgctccacagtggatgagaaagag
cagaagcagctcctcatggatctggatgtggtgatgaggagtagcgactgcccgtacata
gtccagttctacggagcgctattcagagagggtgactgctggatctgcatggagctcatg
gctacctcgttcgacaagttttacaaatatgtatatagctctttagatgacgttattcca
gaggagatcttaggcaaaatcactttagcgactgtgaaagccttaaatcatttaaaagaa
aacttgaaaatcattcacagagacatcaaaccttccaatattctcctggatacaaacgga
aacatcaaactgtgtgactttggcattagcgggcagctggtggattccattgccaagacc
agagatgccggctgcagaccttacatggcaccagaaagaatagacccaagtgcgtcccga
cagggatacgatgtccgctccgacgtgtggagcctcgggatcacgctatacgagttggcc
acaggccgctttccctaccccaagtggaacagtgtgtttgatcagctgacacaggttgtg
aaaggggaccccccgcagctcagcaactcggaggagcgggagttctcccccagcttcatc
agtttcgttaatcagtgccttaccaaggacgagtcaaaaagaccaaaatacaaagaactt
ctgaaacaccctttcatcctgatgtacgaggagcgcacggtggaggtggcggggtacgtg
ggtaagatcctggagcagatgccggcctcccccagctcccccatgtacgtcgattga

DBGET integrated database retrieval system