KEGG   Xenopus tropicalis (western clawed frog): 100135131Help
Entry
100135131         CDS       T01011                                 

Gene name
uros
Definition
uroporphyrinogen III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100135131 (uros)
Enzymes [BR:xtr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     100135131 (uros)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 262 aa AA seqDB search
MKVLLLKDPKTKDLASDPYVKELSSYGLQATLIPVLSFKFVSLDHFFDKLSHPESYAGLI
FTSPRAVEAVKLCLQTPDHKEAWNDRLCAKWNSKPVYVVGKATASLVEEIGLSSEGEGSG
NAEKLAECICSKGLSYSAPILFPCGSLKREVLPKKLQEKKVPLETITVYQTAPHPAVQDS
LMNYFTKEGVPASVVFFSPSGVKYCLKFLKDLPNDQLNQIKFGAIGPTTAEAMAEEGIPV
SCTALNPTPQDLAIGIKQADMQ
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttttattactgaaagaccccaaaactaaggatttggcttcagatccatatgtt
aaggaattgtcatcgtatggattacaggcaacattaattcccgtgttatccttcaaattt
gtgtccctggatcatttctttgacaagctttcccacccagagagttatgctggtctcata
tttaccagcccaagagcagtagaagccgtgaaattatgtttgcaaacacccgatcataaa
gaagcttggaatgaccggctctgtgccaagtggaattctaaacccgtttatgtggttggc
aaagctacagcctctttggttgaagagattggcctttcgtcagaaggagaagggtcagga
aatgcagaaaagcttgcggaatgtatctgctcaaagggattatcgtattctgcacccatt
ctttttccttgtggatctttgaaaagagaggttcttcctaaaaaacttcaagaaaaaaag
gtacctctagagaccattacggtttatcagactgccccgcatcctgccgtacaagactct
cttatgaattatttcactaaggaaggtgtcccagcaagtgttgtgttctttagtccgtct
ggagtaaaatattgtctcaagtttctcaaggacctacctaatgatcagcttaatcaaata
aagtttggcgccattggccctacaactgcggaagcaatggccgaagaaggcatcccggtg
tcatgcactgctctgaaccccacgcctcaggacttagcaataggaataaagcaagctgac
atgcaataa

DBGET integrated database retrieval system