KEGG   Xenopus tropicalis (western clawed frog): 100135191Help
Entry
100135191         CDS       T01011                                 

Gene name
ugt1a6
Definition
UDP glucuronosyltransferase 1 family, polypeptide A6 (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100135191 (ugt1a6)
   00053 Ascorbate and aldarate metabolism
    100135191 (ugt1a6)
   00500 Starch and sucrose metabolism
    100135191 (ugt1a6)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100135191 (ugt1a6)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100135191 (ugt1a6)
   00860 Porphyrin and chlorophyll metabolism
    100135191 (ugt1a6)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100135191 (ugt1a6)
   00982 Drug metabolism - cytochrome P450
    100135191 (ugt1a6)
   00983 Drug metabolism - other enzymes
    100135191 (ugt1a6)
Enzymes [BR:xtr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100135191 (ugt1a6)
Glycosyltransferases [BR:xtr01003]
 Others
  Hydrophobic molecule
   100135191 (ugt1a6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 531 aa AA seqDB search
MGATGSSPSCCFFRRFFILLALGCADGGRLLVVPQDGSHWLSMRVLVDRLAQRGHYIVVA
IPEVNMLFKDLDNYKVKTFSSPYSKDVLENRMRRMNQEIFVDRILTEKITFWYESMSNAT
QWVVSACQHFLQNSTLIRELEKEHFDAMLTDSVFPCGEIVAEHLSIPSVSFMRGTIFGMD
QIASQTPSPPSYVPRMFTVYTDNMSFSQRVKNFLIHSLEHIVCHIFYYPYAQMASDFLKK
EVTAMSLFSRTSIWLMRYDFVFEFPRPIMPNVILIGGINCAKQKALPQEFEKLVKSSGEH
GFVVFSFGSMVSEIPMNIAMDIAEALRYIPQKVFWRYTGKAPPNLGDNTHLVKWLPQNDL
LAHPKARAFITHAGSHGVYEGICNAVPMVMLPLIGDQMDNAKRIESRGAGLILNVQNLIP
DDLSNAVMAVIDNPSYKENIQRLSSLHRDRPVQPLDLAVHWVEFVMKHKGAPHLRPAAHD
LNWIQYQSLDVMAFLLAVLLTTLFISLKCSTFACRCCCKRNTKPKRKTKSE
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgggtgccacaggttcatctccctcctgctgcttctttagaagattcttcatcctgttg
gcgttgggctgtgctgatggtggcaggctgctggtggtcccacaggatggtagccactgg
ctcagcatgcgtgtgttggtggacaggttagcacaaaggggtcactatattgtcgtggcc
atcccagaagtcaatatgcttttcaaggatttagataattacaaagtgaaaacattctct
tcgccttacagcaaagacgttttggaaaaccgcatgaggcgtatgaaccaagaaatattt
gtagaccggattcttacagagaagattacattctggtatgaaagcatgtcaaacgctaca
cagtgggttgtgagtgcgtgtcagcacttcctgcagaactcgaccctcattagggaactg
gagaaggaacattttgacgctatgctaactgactcagttttcccatgtggtgagatagtc
gctgaacacctttccatcccttctgtgtccttcatgagggggactatatttgggatggac
caaatagcttctcagacccctagtcctccctcctatgtacccaggatgttcactgtgtat
acagacaatatgtctttcagccagagggtgaagaacttccttatccactccctggaacat
atcgtttgccatattttttattatccatatgcacagatggcttcagattttttgaaaaaa
gaagttactgctatgagtcttttcagccgtacttccatttggctgatgaggtatgacttt
gtctttgaatttcccaggcccataatgccaaatgtgattttaattggaggcatcaactgt
gccaagcagaaggccctaccccaggagtttgagaagttggttaaaagctctggagaacat
ggatttgtggtgttttcctttggatccatggtgtctgaaattcccatgaatatagcaatg
gatatagcggaagctctgagatacattcctcagaaggttttctggaggtacacagggaaa
gcacctccaaatctgggagataacacccatcttgtaaagtggctgccgcagaatgatctg
cttgctcatcccaaagctcgtgcctttatcactcatgctggatcacatggggtttatgag
ggaatttgtaatgctgtccccatggtcatgctgccattaattggggaccagatggataat
gcaaaacgcattgagtctcggggagcaggattgattctcaatgtgcagaacttaatcccc
gatgaccttagcaatgcagtgatggctgttatagacaatccaagctacaaggaaaacatt
cagcgtttgtcctctctgcaccgggacagaccagtccaacccctggaccttgctgtgcac
tgggtagagtttgttatgaaacacaaaggtgccccccacttgcgcccggccgctcatgac
ttgaactggattcagtaccagtccctggatgttatggccttcctactggctgtactgctc
accacactgttcatcagcctaaagtgcagcacttttgcatgtcgttgttgctgtaaaaga
aacaccaagccaaaacgtaaaaccaagtctgagtag

DBGET integrated database retrieval system