KEGG   Xenopus tropicalis (western clawed frog): 100135279Help
Entry
100135279         CDS       T01011                                 

Gene name
hist1h2bm
Definition
histone cluster 1, H2bm
Orthology
K11252  
histone H2B
Organism
xtr  Xenopus tropicalis (western clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 124 aa AA seqDB search
MPEPAKAAPKKGSKKAVTKTAGKGGKKRKRTRKESYAIYVYKVLKQVHPDTGISSKAMGI
MNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKY
TSSK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaacccgccaaagctgcgcccaagaagggctccaagaaagccgtgacgaagacc
gccggcaaagggggaaagaagcgcaagaggaccaggaaggagagctacgccatctacgtg
tacaaagtgctgaagcaggtccatcctgacaccggcatctcctccaaggccatgggcatc
atgaactcgttcgtcaacgacatcttcgagcgcatcgccggtgaggcttctcgtctcgcc
cactacaacaagcgctccaccatcacctccagagagatccagaccgccgtgcggctgctg
ctgcccggagagctggccaaacacgccgtgtccgagggtaccaaggccgtcaccaaatac
accagctccaagtag

DBGET integrated database retrieval system