KEGG   Xenopus tropicalis (western clawed frog): 100135279Help
Entry
100135279         CDS       T01011                                 

Gene name
hist1h2bm
Definition
histone cluster 1, H2bm
Orthology
K11252  
histone H2B
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100135279 (hist1h2bm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 124 aa AA seqDB search
MPEPAKAAPKKGSKKAVTKTAGKGGKKRKRTRKESYAIYVYKVLKQVHPDTGISSKAMGI
MNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKY
TSSK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaacccgccaaagctgcgcccaagaagggctccaagaaagccgtgacgaagacc
gccggcaaagggggaaagaagcgcaagaggaccaggaaggagagctacgccatctacgtg
tacaaagtgctgaagcaggtccatcctgacaccggcatctcctccaaggccatgggcatc
atgaactcgttcgtcaacgacatcttcgagcgcatcgccggtgaggcttctcgtctcgcc
cactacaacaagcgctccaccatcacctccagagagatccagaccgccgtgcggctgctg
ctgcccggagagctggccaaacacgccgtgtccgagggtaccaaggccgtcaccaaatac
accagctccaagtag

DBGET integrated database retrieval system