KEGG   Xenopus tropicalis (western clawed frog): 100135289Help
Entry
100135289         CDS       T01011                                 

Gene name
mos, c-mos, msv, p39
Definition
v-mos Moloney murine sarcoma viral oncogene homolog (EC:2.7.11.1)
Orthology
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
Oocyte meiosis
Regulation of actin cytoskeleton
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100135289 (mos)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100135289 (mos)
  Cell growth and death
   04114 Oocyte meiosis
    100135289 (mos)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100135289 (mos)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100135289 (mos)
Protein kinases [BR:xtr01001]
 Serine/threonine protein kinases: Other group
  MOS family
   100135289 (mos)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 189 aa AA seqDB search
MEFAGNINLQKLIYGLTDLLPVEKCIKYSIDIARALQHLHAHGVVHLDLKPANVLLSEQG
VCKIADFGCSFKISSTSDTVTHMNEIGGTFTHRAPELLKGEEVSPRVDVYSFGITMWQLL
TREPPYEGDRQYILYAVVAYNLRPSTSRNVFTQSSIGQTCQKLISRCWDGDPSIRPTADK
LVDELSVLL
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggagttcgcaggcaatataaatctacagaagctcatttatgggctcacagacttgctt
cctgtagagaagtgtataaagtattcaatagacatcgcgcgcgccctccagcacctgcac
gcgcacggcgtagtgcacctggatttaaaaccagccaatgtcttgttgtcagaacagggt
gtttgtaaaatcgcagattttgggtgctcgtttaaaatatccagcacaagtgacaccgtg
acgcacatgaatgaaatcggcggcacgtttacgcaccgggcgcccgagctgctgaaaggt
gaggaagtgtctccgcgcgtggacgtttattcttttggcatcacgatgtggcagctgctc
acccgagagccgccctatgagggagacagacagtatatcctgtacgctgttgtggcgtat
aacctgcgcccttcgaccagcaggaatgtttttacccagtcttctattggacagacttgt
caaaaactgatcagccggtgttgggacggcgaccccagcatccgaccgaccgcagataag
ctcgtcgacgaactttcagttttactgtaa

DBGET integrated database retrieval system