KEGG   Xenopus tropicalis (western clawed frog): 100144638Help
Entry
100144638         CDS       T01011                                 

Gene name
nlk, Xnlk, nlk1
Definition
nemo-like kinase (EC:2.7.11.24)
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Adherens junction
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:xtr04010]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:xtr04310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:xtr04068]
Cellular Processes; Cell communication; Adherens junction [PATH:xtr04520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 534 aa AA seqDB search
MSLCGTSSNANMMAAYNGGTSTAAGGHHHHHHHHLAHLPPPHLHHHHHLHPQHHLHPGSA
AAVHPVQQHVSSSSASTSSSAAAAAAAAAAAAAMLNPGQAQSYFPSPAPGQAPGPAAAVA
PAQVQAAAVKAHHHQHSHHAQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVF
QNLVSCKRVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSP
QPLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDE
SRHMTQEVVTQYYRAPEILMGSRHYTNAIDVWSVGCIFAELLGRRILFQAQSPIQQLDLI
TDLLGTPSLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPS
KRISAKDALAHPYLDEGRLRYHTCMCKCCFSTSSGRVYTSDFEPITNPKFDDTFEKNLSS
VRQVKEIIHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgtctctttgtggcacatcttccaatgcaaatatgatggcggcatataatgggggcaca
tcaacagcagctggggggcaccaccaccatcatcaccatcaccttgcccatttgccccct
ccccacctacaccatcatcatcacctccatcctcagcatcatctgcacccaggctcagca
gcagctgtgcaccctgttcagcaacatgtctcctcttcatcagcttccacttcctcctca
gctgccgcagctgctgcggcagcggcggcagcagcagcaatgctaaatccagggcaggcc
cagtcctactttccatctccagctccaggccaagctccaggtcctgcagcagcagtggcc
cctgctcaggttcaggctgctgctgtaaaggctcaccaccatcagcactctcatcatgcc
cagcaactggatattgaacctgatcggcccattggttatggcgcatttggagttgtctgg
tcagtaacagatccaagagatggaaaaagagttgctctaaaaaagatgcccaacgtcttc
cagaatctagtctcttgcaagagggtcttccgagaactgaagatgttgtgtttttttaaa
catgacaacgtactctcagcacttgatattctccagccacctcatattgattattttgaa
gaaatatatgttgtcacagaattaatgcagagtgacctccataagatcattgtctctcct
cagccgcttagttcagatcatgtcaaggtttttttgtatcagattttaagaggtctgaag
tatttgcattcagctggcattttacatcgagatattaaaccagggaatctacttgtgaac
agcaactgcgttcttaagatctgtgattttggattggcaagggttgaagaacttgatgaa
tctcggcatatgactcaggaagttgtcactcagtattatcgggctccagaaatcctcatg
gggagtcgacattataccaacgctatagacgtctggtctgtaggatgcatttttgcagag
ttacttgggcgaagaatattgtttcaggctcaaagtccaatccaacagttggacttaatc
actgatttgttgggtacaccgtcactagaagcaatgagaacggcttgtgaaggagccaag
gcacacatactcaggggtcctcataaacagccatctcttcctgtcctgtacacactgtcc
agccaggcaactcacgaagctgtccatctactctgcaggatgttggtctttgatccatct
aaaaggatatcagctaaagatgccttggctcacccatacctggatgaaggccgcttgcga
tatcacacttgcatgtgcaaatgttgtttttcaacttcttctgggagggtctacaccagt
gatttcgagcctatcacaaatccaaaatttgatgacacttttgaaaagaacctcagttct
gttcggcaggtgaaagaaataattcatcagtttatattggaacagcagaaaggaaacaga
gttcctctgtgcatcaatcctcagtctgctgcttttaaaagctttataagttccactgtt
gctcaaccctctgagatgccgccatctccactggtttgggagtga

DBGET integrated database retrieval system