KEGG   Xenopus tropicalis (western clawed frog): 100144638Help
Entry
100144638         CDS       T01011                                 

Gene name
nlk, Xnlk, nlk1
Definition
(RefSeq) nemo-like kinase
  KO
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100144638 (nlk)
   04310 Wnt signaling pathway
    100144638 (nlk)
   04068 FoxO signaling pathway
    100144638 (nlk)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    100144638 (nlk)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100144638 (nlk)
Protein kinases [BR:xtr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100144638 (nlk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
Position
2
AA seq 534 aa AA seqDB search
MSLCGTSSNANMMAAYNGGTSTAAGGHHHHHHHHLAHLPPPHLHHHHHLHPQHHLHPGSA
AAVHPVQQHVSSSSASTSSSAAAAAAAAAAAAAMLNPGQAQSYFPSPAPGQAPGPAAAVA
PAQVQAAAVKAHHHQHSHHAQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVF
QNLVSCKRVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSP
QPLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDE
SRHMTQEVVTQYYRAPEILMGSRHYTNAIDVWSVGCIFAELLGRRILFQAQSPIQQLDLI
TDLLGTPSLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPS
KRISAKDALAHPYLDEGRLRYHTCMCKCCFSTSSGRVYTSDFEPITNPKFDDTFEKNLSS
VRQVKEIIHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgtctctttgtggcacatcttccaatgcaaatatgatggcggcatataatgggggcaca
tcaacagcagctggggggcaccaccaccatcatcaccatcaccttgcccatttgccccct
ccccacctacaccatcatcatcacctccatcctcagcatcatctgcacccaggctcagca
gcagctgtgcaccctgttcagcaacatgtctcctcttcatcagcttccacttcctcctca
gctgccgcagctgctgcggcagcggcggcagcagcagcaatgctaaatccagggcaggcc
cagtcctactttccatctccagctccaggccaagctccaggtcctgcagcagcagtggcc
cctgctcaggttcaggctgctgctgtaaaggctcaccaccatcagcactctcatcatgcc
cagcaactggatattgaacctgatcggcccattggttatggcgcatttggagttgtctgg
tcagtaacagatccaagagatggaaaaagagttgctctaaaaaagatgcccaacgtcttc
cagaatctagtctcttgcaagagggtcttccgagaactgaagatgttgtgtttttttaaa
catgacaacgtactctcagcacttgatattctccagccacctcatattgattattttgaa
gaaatatatgttgtcacagaattaatgcagagtgacctccataagatcattgtctctcct
cagccgcttagttcagatcatgtcaaggtttttttgtatcagattttaagaggtctgaag
tatttgcattcagctggcattttacatcgagatattaaaccagggaatctacttgtgaac
agcaactgcgttcttaagatctgtgattttggattggcaagggttgaagaacttgatgaa
tctcggcatatgactcaggaagttgtcactcagtattatcgggctccagaaatcctcatg
gggagtcgacattataccaacgctatagacgtctggtctgtaggatgcatttttgcagag
ttacttgggcgaagaatattgtttcaggctcaaagtccaatccaacagttggacttaatc
actgatttgttgggtacaccgtcactagaagcaatgagaacggcttgtgaaggagccaag
gcacacatactcaggggtcctcataaacagccatctcttcctgtcctgtacacactgtcc
agccaggcaactcacgaagctgtccatctactctgcaggatgttggtctttgatccatct
aaaaggatatcagctaaagatgccttggctcacccatacctggatgaaggccgcttgcga
tatcacacttgcatgtgcaaatgttgtttttcaacttcttctgggagggtctacaccagt
gatttcgagcctatcacaaatccaaaatttgatgacacttttgaaaagaacctcagttct
gttcggcaggtgaaagaaataattcatcagtttatattggaacagcagaaaggaaacaga
gttcctctgtgcatcaatcctcagtctgctgcttttaaaagctttataagttccactgtt
gctcaaccctctgagatgccgccatctccactggtttgggagtga

DBGET integrated database retrieval system