KEGG   Xenopus tropicalis (western clawed frog): 100144684Help
Entry
100144684         CDS       T01011                                 

Gene name
nlk.2, xnlk
Definition
nemo-like kinase, gene 2 (EC:2.7.11.24)
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100144684 (nlk.2)
   04310 Wnt signaling pathway
    100144684 (nlk.2)
   04068 FoxO signaling pathway
    100144684 (nlk.2)
 Cellular Processes
  Cell communication
   04520 Adherens junction
    100144684 (nlk.2)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100144684 (nlk.2)
Protein kinases [BR:xtr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100144684 (nlk.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 454 aa AA seqDB search
MAFQGPGRSLPGQLCAGVFGGLIQPPLGQKFYCPNGGSGGGGVPAVPSPLPQALSAPQCN
GDGRGEPEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCF
FKHDNVLSALDILQPPQIDCFEEIYVITELMQTDLHKVIVSPQPLSSDHIKVFLYQILRG
LKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESQHMTQEVVTQYYRAPEI
LMGSRHYRSAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPPLTAMRSACEG
ARAHILRGPHKPPSLSVLYMLSGEATHEAVHLLCRMLLFDPLKRISAKDALAHPYLEEGR
LRYHTCMCHCCYSVSSGRVYTADFEPTATNRFDDSYEKSLTSVWQVKELVHRFITDQQQG
KRPPLCINPHSAAFKTFIRSTAWHSSKVSKKEER
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttcagggcccggggcgctccctgccggggcagctttgcgctggggtatttggc
ggcctcattcagcccccgctggggcaaaagttctactgtcccaatggggggagcggcggg
ggaggggtgccggctgtgccctcccctttgccccaagcgctcagcgccccccagtgtaac
ggggatgggaggggggaaccggagcccgacaggcccatcggatacggggcattcggagtg
gtctggtcggtgactgaccctcgggatggcaaacgcgttgctctcaagaagatgccaaac
gtcttccagaacctggtgtcctgcaagagggtcttcagagaactcaaaatgctctgcttc
ttcaaacacgacaatgtcctgtcggcactggatatcctgcagcccccgcagatcgactgc
ttcgaagagatatatgtgatcacagagctgatgcagacggatctacacaaggttatagtg
tccccgcagccactcagctccgaccacatcaaggttttcctctatcagatcctacgcggc
ctgaagtatttgcactcggctgggatcctgcacagagacattaaaccggggaacctgctt
gtcaacagcaactgtgtcctgaagatctgtgactttggcctggcccgggtggaggaactg
gacgagtcccagcacatgacccaggaagtagtgactcagtactaccgggcccctgagatc
ctgatggggagtcggcactaccgcagtgccatcgatatctggtctgtcggctgcatcttc
gctgaactcctggggcgcaggatcctgttccaggcacaaagccccattcagcagctggac
ctgatcaccgacctcctgggcaccccccctctcaccgcaatgcgctcggcctgtgaggga
gcaagagctcacattctgcgtgggccccacaagccgccgtccctctcggtcctgtacatg
ctgtcgggagaagctacccatgaggccgttcacctcctgtgccggatgctgctgtttgac
ccgctgaagcggatctctgccaaggatgccctggcccacccctacctggaggaagggcgc
ctgcgctaccacacgtgtatgtgtcactgctgctactccgtgtcctctgggcgtgtctac
actgcggacttcgagcccacggccaccaaccgatttgatgactcctacgagaaaagcctc
acctccgtctggcaggtcaaagagctggttcatcgctttatcacagaccaacaacaggga
aagcgcccccctctgtgcattaatccgcactctgccgccttcaaaaccttcatcagatcg
acggcatggcattcctcaaaggtttccaagaaggaagagagatga

DBGET integrated database retrieval system