KEGG   Xenopus tropicalis (western clawed frog): 100144735Help
Entry
100144735         CDS       T01011                                 

Gene name
usp5, isot
Definition
ubiquitin specific peptidase 5 (isopeptidase T) (EC:3.1.2.15)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100144735 (usp5)
Peptidases [BR:xtr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100144735 (usp5)
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100144735 (usp5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 832 aa AA seqDB search
MGDVKDALLSVLPTIRLPRAGDRVHKDECAYTFHTPETDSGLYICMNTFLGFGRPYVERQ
YNKTGQRAFLHLKRTAKMKSEESNSGTGDPPRKKPTRLAIGMEGGFDMSEEQCEYEEVVK
LVILPEFLEIPRDGLLGLPEMVRDRVSSAIDAILSADSASRKQEIQAWDGEVRQVSKHAF
NLQQLEGVPRIPPCGWKCSVCDLRENLWLNMTDGAILCGRRYFDGSGGNNHALQHYQETG
YPLAVKLGTITPDGGDVYSYDEDDMVLDPNLAEHLSHFGIDMMKMQKTDKTMTELEIDMN
QRIGEWEVIQESGVQLQPLYGSGYTGIQNLGNSCYLNSTMQVIFSIPAFQRKYVERMEQI
FQKSPADPTQDFNTQVAKLGNGMLSGEYSKPAVEKDNDTAPEHKGLQDGIAPRMFKALVG
KGHPEFSTNRQQDAQEFFLHFINMVERNCRSSSNPNEVFRFLVEEKIKCLVSQKVKYTQR
VEYILQLPVPMEAALNKDELSAYEQCRLQAEREHRPPPELVRARIPFTSCLEAFAAPEQL
DEFWSAALQAKSNALKTSRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIDVPDELDLSEF
RGGGLQGGEEELPDVAPPLVTPDEPKAPVLDESVVTQLVEMGFPAEACRKAVYYTGNSGA
EAAMTWVMSHMDDPDFALPLSGASAPSSVTTGGDPPSEEHVATIISMGFSQEQAVKALRA
TNNNLERAVDWIFSHIDDLDAEAAMDLSEGRSAAESVSESLPAAGPRVRDGAGRYELFAF
ISHMGTSTMCGHYVCHIKKEGRWVIYNDQKVCASEKPPKDLGYIYFYQRIQS
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgtgaaagatgctctgctctctgtgctaccgaccattcggctacctcgggct
ggggaccgagtgcacaaggatgagtgtgcatataccttccatactccggagacagacagc
ggattatatatttgtatgaatacatttctgggctttgggaggccctatgttgagcggcaa
tacaacaagactgggcagagagcctttctgcatcttaagaggactgctaaaatgaaatct
gaggaatctaattccggcacaggagaccccccacgcaagaagccgacacgcttagccatt
ggaatggagggcggctttgacatgagtgaggaacagtgtgaatatgaggaggtggtgaag
ttggtcattctgcctgagttcctagagattccacgggatggactgttggggctcccggag
atggtcagggatcgggtgtcgtctgctattgatgccatactgtctgctgactccgcctcc
cggaaacaggaaattcaggcctgggacggggaagtgaggcaggtttccaaacatgcgttc
aacctccagcagcttgagggggtaccccgtatcccaccttgtggatggaagtgcagtgtc
tgtgatctgcgggagaatctgtggctcaatatgacagacggcgccatcctctgcggaaga
cgttactttgatggcagcggagggaataaccacgcgttacagcactaccaagaaacaggc
tacccgttagcagtgaaactgggtaccattacgccagatggaggcgatgtatattcctat
gatgaggatgatatggttctggaccccaacctggcagagcatctctcacactttggcatt
gacatgatgaagatgcagaagacggataagaccatgacagaactggaaattgatatgaac
caacgaatcggagagtgggaggtgatccaggaatcaggtgtacaattgcagcccctctat
ggttcggggtacactggcatccagaacctcggaaacagctgctacctcaattcaaccatg
caagtcatcttcagcatcccggccttccagcgcaaatacgtagaacgtatggagcagatt
ttccagaaatcacctgctgatccaacgcaagacttcaacacccaagtagccaagcttgga
aatggcatgttatctggggaatactcaaagccagctgtagaaaaagacaatgacacagct
ccagaacataagggtcttcaggatgggattgctccgagaatgtttaaggcacttgttggg
aagggacacccagagttttccaccaacaggcagcaagatgctcaggaattcttcctgcac
tttataaatatggttgagaggaactgccgcagctcatccaaccccaatgaagttttccgt
ttcctagtggaagagaagattaagtgtctggtgtctcagaaagtgaagtatacacagagg
gttgagtacatcctgcaacttcctgtgcctatggaggctgcactcaataaggacgagctg
tctgcatatgagcaatgccggctccaggctgaacgtgagcatcgccccccgccagaacta
gtccgggcacggatcccattcacatcatgtttggaggcatttgctgcccctgagcagctc
gatgaattctggagcgccgcccttcaggccaaatccaatgcacttaagacgtcccgcttt
gcctcatttccagattacttggtcattcaaatcaagaagtttacttttggccttgactgg
gtacccaagaaactggatgtctctattgatgtcccagatgaattggatctttctgagttt
cggggtggggggcttcaagggggggaagaggagctcccagatgttgcccccccattggtc
acacccgatgagcccaaagctccagtgctggacgagtcagtagtcacgcagttggtagag
atgggattcccagccgaggcgtgccgcaaagctgtgtattacacgggcaacagcggggca
gaggctgcaatgacgtgggtgatgtcgcacatggatgacccagactttgccttgccactg
tctggggccagcgcaccctcatcagttactaccgggggggatccaccctctgaggaacac
gtagcaacaataatatccatgggcttctcccaggagcaagcagtgaaagccctccgtgcc
actaacaacaacttggaacgtgctgtcgactggatcttctctcacattgatgatttggat
gctgaggctgccatggatttatctgagggtcgctctgctgcagagtctgtgtctgagagt
ctccctgctgcgggccctcgtgtgagggatggagctgggagatatgagctttttgccttc
atcagtcacatggggacatccaccatgtgcggtcactacgtgtgtcatataaagaaggag
ggaaggtgggtgatctacaatgaccagaaagtctgcgcttcagagaagcctcccaaagac
ctgggttacatttacttctaccagcgtatacagagttaa

DBGET integrated database retrieval system