KEGG   Xenopus tropicalis (western clawed frog): 100144739Help
Entry
100144739         CDS       T01011                                 

Gene name
cyld, cdmt, cyld1, cyldi, eac, hspc057, mft, mft1, sbs, tem, uspl2
Definition
cylindromatosis (turban tumor syndrome) (EC:3.1.2.15)
Orthology
K08601  
ubiquitin thioesterase CYLD [EC:3.1.2.15]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    100144739 (cyld)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100144739 (cyld)
Peptidases [BR:xtr01002]
 Cysteine Peptidases
  Family C67
   100144739 (cyld)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 974 aa AA seqDB search
MSGALWGQEKSSSSYWEERIFYLLLQEASVLDKQTQKQIKVPRGSIGQYVQERSAVAHSR
GITSSKSKKLQIALKILDQSHALLIMDEKEVYEIGEKMAELLLAITNCEERYSLFKNKAR
LTKAMQIEPGSAVRVCLRPGEIFPGVVRYRGPLLPDRSPNGIWFGVELLEDGRGQGFTEG
SYQGKQHFRCDEECGVFVAVDKLELCEDDDEDIESDYASPADNSQSEIPPLEINSRVSLK
IGEGMEFGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRYNGIQLCSFASVESTLLLHI
NDIIPESITQDRRPLKLAYMSRCGSEKNLSSHSKPKVTGSTSESGSRTRSEFFYTLNGSS
VETQHQSKSKNTWYMDEARERSSRGSSGVQENSRCETVEDSAKSLTDSSHAAFGHCSPPL
QPSASSNSPGENRFHSLPFSLSKMSSTNGTMGHTPLSLSVQSVIGELNNVSLQDIPPRFT
HISNLHGLEVGSLAEVKENPPFYGVIRWIGQPAGVNEMLAGLELEDECAGCTDGTFKGTR
YFTCAPKKALFVKLKSCRPDSRFASLQPVSNQIERCNSLAFGGYLSEVVEGNTPPRTEKE
GLEVMIGKKKGIQGHYNSCYLDSTLFCLFSFSSVLDSVLLRPKEKTDVEYYSETQALLRT
EIVNPLRIYGYVCATKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHHILRVDPLLKI
RSAGQKVQDCYFYQIFMDKNENVGVPTIQQLLEWSFINSSLKFAEAPSCLIVQMPRFGKD
FKMFNKIFPSLDLNITDLLEDTPRQCRICGGLAMYECRECYDDPDITAGKIKQFCKICNT
QVHLHPKRQHHKFNPVSLPKELPDWDWRHGCIPYQKMDLFAVLCIETSHYVAFVKYGRDD
SSWVFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEELHALDSRNIQGCARRLLCDA
YMCMYQSPTMSLYK
NT seq 2925 nt NT seq  +upstreamnt  +downstreamnt
atgagtggagctctctgggggcaagagaaaagcagctcttcttactgggaggagcgtatt
ttttacttgctgctccaagaggccagtgtgcttgataaacaaacccaaaagcaaatcaaa
gttcccagaggcagcattggccagtatgttcaggaacgatcggccgtggcacatagcagg
ggcataacttcctctaaaagcaaaaagttgcagatagcactgaagatcctggatcagtct
catgctctcttgattatggatgagaaagaagtttatgaaatcggggaaaaaatggctgag
ttgcttttagccattacaaactgtgaggaaaggtacagcctcttcaagaataaggcaaga
cttacgaaagccatgcagatagagcctggctctgcagtgcgggtgtgtttaaggcctgga
gaaatctttcctggagttgtacgttacaggggacctttgttaccagataggtctcccaat
gggatatggtttggagtagagttactggaagatggacggggccaaggttttacagagggc
tcctaccagggcaagcaacatttcagatgcgatgaagaatgtggagtgtttgtagctgta
gacaagttagagctatgtgaggatgacgatgaggacattgagagtgattatgcatctcct
gcagacaacagtcagtcagagatccctcccctagagatcaattccagagtgtctttaaag
attggggagggtatggagtttggaactgttatattttgtgatgttctgcctggaaaagaa
agtcttggatactttgttggagttgacatggacaaccctataggaaactgggatggaaga
tacaatggaattcaactctgtagctttgcaagtgttgagagcacccttcttctccatatt
aatgatataattccagagtccataacccaggacaggagacctctgaaattagcatatatg
tcgagatgtggcagcgaaaaaaacttgtccagtcatagcaaaccaaaggttacaggatct
acctcggagtcaggaagccggacacgttcagaatttttttatacgttaaatggaagttcg
gttgaaacacaacaccagtcaaagtcaaaaaatacttggtacatggatgaagcccgtgaa
agatcctccaggggaagttctggtgttcaggagaacagccgctgtgagactgttgaagac
tctgcaaaatcgctaacagattcatcccatgctgcgtttgggcattgttctcctcctctt
caaccttctgcaagtagcaattctcctggtgaaaacagattccactccttgcccttcagc
ctctctaaaatgtccagtaccaatggaacaatgggtcatacccccctctctttgtctgtg
cagtctgttattggagagcttaacaatgtatcccttcaggatatcccacctaggtttact
catatatcaaacttacatggtctagaagtgggttcattggctgaagttaaggagaaccct
cctttttatggggtgatccgctggattgggcagcctgcaggagttaatgagatgctagct
ggactagaactggaggatgaatgtgcaggatgcacagatggcactttcaaagggacaaga
tatttcacttgcgcccctaaaaaagcactttttgtaaagctaaagagttgtcggccagac
tctaggtttgcatcgcttcaaccagtctccaaccagattgaacgatgtaattctttagct
tttggaggatacttgagtgaggttgtagaagggaacacacctccaagaacagaaaaggaa
ggactagaagtgatgatagggaagaaaaaagggatccaaggacattacaactcttgctat
cttgattcaacattattctgccttttttcattcagctccgtattagactcagttctcctg
agacctaaagagaaaacagatgtggagtattacagtgaaactcaagcacttttaaggaca
gaaatagtgaatcctctgagaatatacggatatgtttgtgcaacgaaaattatgaaatta
agaaaaattttggaaaaagtagaggcggcatcaggatttacatctgaggaaaaagatcca
gaagaatttttaaacattttgtttcatcacatactgagggtggatccattgctgaaaata
aggtcagcaggtcagaaggtacaggactgctacttctaccagattttcatggacaagaat
gaaaatgttggggtccccacaatacaacagcttttagagtggtcctttatcaacagcagt
ttgaagtttgcagaggctccctcttgtttaattgtccagatgcctcggtttggcaaagac
ttcaaaatgttcaacaaaatattcccttccttggatttgaacatcacagatttactggaa
gacactccccgtcagtgccgcatatgtggaggtcttgctatgtacgaatgcagagagtgc
tacgatgatccagatattactgcagggaaaattaagcagttttgcaaaatatgcaacacc
caggttcatctccatcctaaaaggcagcatcataaattcaacccagtgtctcttcctaaa
gaactcccagactgggactggagacatggatgtataccgtaccagaagatggacttgttt
gctgtattatgcattgagaccagtcactatgtggcatttgttaagtatggcagggatgat
tcttcttgggttttcttcgacagtatggctgatcgggatggtggccagaatgggtttaac
atcccacaagtcactccgtgtccagaggttggagaatacctgaaaatgtcccttgaagaa
cttcacgccttagattctcgaaacatacagggctgtgcaaggcggctcctgtgcgatgcc
tatatgtgcatgtaccagagccctactatgagtttatacaagtaa

DBGET integrated database retrieval system