KEGG   Xenopus tropicalis (western clawed frog): 100145138Help
Entry
100145138         CDS       T01011                                 

Gene name
hat1
Definition
histone acetyltransferase 1 (EC:2.3.1.48)
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100145138 (hat1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 426 aa AA seqDB search
MANEEYKAQTERTRLPDSLLGLSAMEKKLAEYKCDTNEAIKLKLVRFPEDIEDESMTFNP
EYSHQIFGDEEVAFGYKGLKILLYYSAGNLSNMFRVEYSSKVDDKFDLVQPDDVENKIRE
LIPSGFCCGSDDFISLLEKEVNFKPMGTVVHTYTVHNEEAGEDITYQIYKADMTCPGFRE
YHERLQTFLMWFIETASYIDVDDEKWDYFLVFEKYNKDGATLYATVGYMTVYNYYVYPDK
TRPRVSQMLVLPPFQGEGHGAQLLETVHRYYVSASNILDITAEDPSENFVRLRDFVLVKL
CQNLPCFSLEKLLCGFSQEMVTEAQEKLKINKKHARRVYEILRLRATDMSDSEKAKAYRL
DVKKRLVGPYKKNQREMAKMKQCLRPEELTNQMNQIDLNTQHEQLEESYQQLVEEYRRIV
ERLAQA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgaagagtacaaggcccaaacagaaagaaccagattaccagatagcctttta
ggtctctctgctatggaaaagaaattagccgagtacaaatgtgacacaaatgaagcaata
aagctaaaattagtacgctttccagaagacatcgaagatgagagcatgacatttaaccca
gagtacagccaccagatttttggtgacgaagaggtagcctttggatacaaaggtttgaag
atcttgttgtactacagtgctggaaacttatctaatatgtttcgggtggagtacagctct
aaagttgacgataagtttgatttggtccagccagatgatgttgaaaataaaatccgtgaa
ctcattccttcgggtttttgttgtggttccgatgattttatatctttgttggaaaaagag
gtgaattttaaacctatggggaccgttgttcacacttacactgttcacaatgaagaggct
ggtgaagatatcacatatcagatatataaggctgacatgacatgtccaggctttcgagag
taccatgaaagactccaaaccttcttgatgtggtttattgaaactgctagctatatagat
gtagatgacgagaaatgggactactttctagtatttgagaagtataataaggatggagct
acactctatgcaaccgtaggctacatgacagtctataattactacgtgtacccagacaaa
acccggccacgtgtaagtcagatgttggttttgccaccatttcaaggggaaggtcacggc
gcccagctcttggaaactgtccacagatattatgtatctgcttccaatattttggacatc
acagctgaagatccgtcagaaaactttgtccgtcttagagactttgttcttgtgaagctt
tgtcaaaaccttccgtgcttttctcttgaaaaacttttgtgtggattcagccaagagatg
gtgacagaggctcaagaaaaactcaagattaacaagaaacatgcaaggcgagtgtatgaa
atccttcggttacgagcaacagacatgagtgattctgagaaagccaaagcgtacagactg
gatgtaaaaaaaagacttgtggggccatacaagaaaaatcagagagagatggctaagatg
aaacagtgcctccggcctgaagagctgaccaaccagatgaaccagatcgatctaaacacg
cagcatgagcagttagaggagagctatcagcagctggtggaggaatacaggcggatagtg
gagcggcttgctcaggcgtag

DBGET integrated database retrieval system