KEGG   Xenopus tropicalis (western clawed frog): 100145152Help
Entry
100145152         CDS       T01011                                 

Gene name
gpx2
Definition
glutathione peroxidase 2 (gastrointestinal) (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100145152 (gpx2)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100145152 (gpx2)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100145152 (gpx2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 190 aa AA seqDB search
MAYIAKSFYDLYATNIDGEKVDFNVFRGRVVLIENVASLUDTTVRDYTQLNELQTKYPRR
LVVLGFPCNQFGYQENCKNEEILNSLKYVRPGKGFVPGFTLFQKCDVNGKDTHSVFAYLK
DKLPVPDNEPAALISDPRYIVWNPVHRSDISWNFEKFLIGPEGEPFKRYNKNFQTISIEP
DIQRLLKLTK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggcttacatagcaaagtcattctatgacctatatgctacaaacatagatggggagaaa
gtagatttcaatgtgtttaggggaagggtggtgttgatagaaaatgttgcttcactttga
gacaccacagtcagggattacacccagcttaatgagctgcagaccaagtatccgcgacgg
cttgtggtgctgggatttccatgcaatcaatttggttatcaagaaaactgtaaaaatgaa
gagattcttaattctttaaaatatgtacgacccggaaaaggctttgtaccaggattcacc
ctgttccagaaatgtgatgttaatggaaaagacactcattcggtttttgcttacttaaag
gacaaactaccagtccctgacaatgagcctgcagcccttattagtgaccccagatatatt
gtatggaatccagtacatcggtctgacatttcctggaactttgagaagtttcttattgga
cctgaaggagaaccattcaaaagatacaacaaaaatttccaaaccatcagtatagaacct
gacatccagagacttcttaagctcaccaaatag

DBGET integrated database retrieval system