KEGG   Xenopus tropicalis (western clawed frog): 100145361Help
Entry
100145361         CDS       T01011                                 

Gene name
gba2
Definition
glucosidase, beta (bile acid) 2
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100145361 (gba2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100145361 (gba2)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     100145361 (gba2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 446 aa AA seqDB search
FIRSHRDLPAWYKSALFNELYFMADGGTVWVEVSAADDDDNLMRRGCKDLPGMKDVLQEY
GRFAYLEGQEYRMYNTYDVHFYASFALIMLWPQLEISLQYDMAASVLQEDPELRKYLMSG
TVAPVKSRSVVPHDVGDPDDEPWQKLNAYLIHDTANWKDLNLKFVLQVYRDYHITKDTTY
LRDMWSVCQTVMETSLKFDEDGDGLIENSGFADQTYDDWVMTGPSSYCGGLWLAAVCMMC
KMAEVLGDGAAQEKFTDILHRGKAAFEKLLWNGKYYNFDCGDQPYSNSVMVDQCAGNWFL
RACGLGAGESEVFPKDHVVSALRTIFELNVKQFADGQMGAVNGMRPDGTTDTSSVQSDEV
WIGVVYGLAATMIHEGLVQEGFATAEGCYRTVWERLGMSFQTPEAYCEKQVFRSLAYMRP
LSIWAMQLALGNLQSAPEQSNCPKGK
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
tttatccgttctcacagagacctcccagcttggtacaaatctgccctctttaatgagctc
tatttcatggcggacggagggaccgtgtgggtggaggtctcggctgctgatgacgatgat
aatctgatgagaaggggctgtaaggacctgcctggcatgaaggacgtcctgcaggaatac
gggcgctttgcttaccttgaagggcaggagtaccgcatgtacaacacatatgatgtgcac
ttctacgcctccttcgctctcatcatgctgtggccccaactggaaatcagtcttcaatat
gatatggctgcctcggtgctgcaggaggaccctgagctgcggaaatatctcatgagcgga
actgtagctcctgtaaagtcacggagtgttgttccacatgatgttggggatccagatgat
gagccctggcagaagcttaacgcctatctgatccatgacacggccaactggaaggactta
aatctcaaatttgtgctccaagtgtatcgggactatcacattactaaggacactacctac
ctgagggacatgtggtctgtgtgccagactgtaatggagacatcgctgaagtttgatgaa
gatggtgatgggctgattgagaattccggctttgctgatcagacctatgatgattgggtg
atgacgggccccagttcatactgcggggggctgtggttggcggctgtgtgtatgatgtgc
aagatggcggaggtactgggggacggcgctgcgcaggagaagttcactgacatcctacac
aggggcaaggcggcatttgagaagcttctgtggaatggtaaatattacaatttcgactgc
ggggaccagccctactctaacagtgtgatggtggatcagtgcgctgggaactggttcctt
cgggcctgcggcctgggtgctggggaaagtgaggttttccccaaagaccatgtggtgagc
gctctgagaaccatctttgagttgaacgtgaaacagtttgcggatgggcagatgggggca
gttaatggtatgcgccccgatggcaccaccgacacatccagtgttcagtccgatgaggtc
tggataggagtggtctatggactggcggccaccatgatccatgagggcctggtgcaggaa
ggttttgccacggccgagggctgttaccggacggtgtgggagcggctgggaatgtccttc
cagacccccgaggcttattgtgagaagcaggtgttccgctcgctggcctacatgcgcccc
ctcagcatctgggccatgcagctagcgctcggcaacctgcaatctgccccagagcagtcc
aactgccccaaggggaagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system