KEGG   Xenopus tropicalis (western clawed frog): 100145372Help
Entry
100145372         CDS       T01011                                 

Definition
uncharacterized LOC100145372
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 235 aa AA seqDB search
MGSTPCSGKGRGVGGFQELGCMPWKVSKQKGEALGGRGSELEDRPNAGTPPTSLQPPAIY
HEKQHRGLCALHALNNVFQDGAAFSRDALQDIYQRLSPSTLVTPHKKNMLGNGNYDVNVI
MAALQTRGFEAVWWDKRRDVGSIALPNVTGFILNVPSNLRWGPLRLPLKRQHWIGVREVA
GVYYNLDSKLRSPHAIGTADELRKFLRHQLRGKNCELLLVVSEEVEVHQTWKSDN
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggggagtactccatgttctggtaaggggaggggggtcgggggctttcaggagttgggt
tgtatgccatggaaggtcagcaagcaaaaaggagaagccttaggtggacgtgggtccgag
ctggaggacaggccgaatgctggaacgccccccacctcgttgcaacctcctgcaatttat
catgaaaagcagcatcgggggttgtgtgctctgcatgcgctaaacaatgtcttccaggat
ggagcggcgttcagtcgtgatgcacttcaggacatctaccagaggctctctcctagcact
ttggtcacaccccacaagaaaaacatgctgggtaatggcaactatgacgtgaatgtcatc
atggctgcattgcagactcgtggatttgaggcagtttggtgggacaagagaagggacgtc
ggtagcattgcattgccaaacgtcactggtttcatcttgaatgtgccatccaatttgcgc
tggggcccattgcgtctgcccctcaagcggcagcactggattggtgtgcgagaagtggca
ggagtttactataacctagactctaaactgcgcagccctcatgccattggaacagctgat
gaactgaggaagttcttgcgtcaccagcttcgagggaagaactgtgaactcctattggtc
gtctcagaggaggtggaagtgcatcagacatggaagtctgataactga

DBGET integrated database retrieval system