KEGG   Xenopus tropicalis (western clawed frog): 100145491Help
Entry
100145491         CDS       T01011                                 

Gene name
mlycd
Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100145491 (mlycd)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100145491 (mlycd)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    100145491 (mlycd)
Enzymes [BR:xtr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     100145491 (mlycd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 509 aa AA seqDB search
MRLLSFLKPKYLQHVADFGLPFPNCMSLGRRGLGCVHYPRLHPYCPKIFARQANSLTPTM
DELLSRSVPPLPPYETKEKCPAPSEIQSINFMQYYRALDKGDRASFLGKLATEFGVDHTQ
VTELSSKVVQAQQKRDMGTVLQVEDRLRYYLTPQYKVLFSHISKLEGGMKFLVDLRADIL
ESLAAKLADGPHIREMNGVLKCMLSEWFSVGFLNLERITWQSPCEVLQKISEYEAVHPVR
NWTDMKRRVGPYRRCYMFAHSAMPGEPLIVLHVALMQNISGSIQAIVKDIPSSEAEDGNK
IQSAIFYSISLTQQGLQGVELGNYLIKRVVKELQVEFPQILEFSSLSPIPGFTKWLLGAL
SSQIKESGRTELFTEAECKEIEDITGGPLSESLKRLFTSSEWMRCERLVNALETPLMRLC
AWYLYGEKHRGFALNPVANFHLQNGAVLWRLNWMADTSPRGGTASCGMMVNYRYFLENTS
ANSAKYLRMKHIEASDQVLNLVSKMNSKL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgcggttgttgtccttcctgaagccaaagtacttgcagcatgttgcagattttgggctg
ccttttcccaattgcatgagtctagggcggcgtggtcttggctgtgttcactatccccgc
ctacatccttattgtccaaaaatctttgccagacaggcaaactcacttactcccacaatg
gatgagttgctgagcaggtctgtgccccctctgcccccctatgaaactaaagaaaaatgc
ccagcgccctctgagatccagagcattaactttatgcagtattaccgggcgctggataag
ggggacagggcttcctttcttggcaagttggctactgagtttggggtggaccatacgcaa
gtgaccgaactaagcagcaaagtggtacaagcccagcagaagagggatatgggaactgtt
ctgcaggtggaggacagactaagatactacctcactcctcaatacaaagtattgttttct
catatcagtaagctggaagggggaatgaagtttctggtggatttgagagctgacatttta
gagagcttagcagctaaactcgcagatggtcctcacattagggaaatgaatggggtgcta
aaatgcatgctttcggagtggttctctgtaggatttcttaacctggagaggataacctgg
cagtccccatgcgaagtgttgcaaaagatcagtgagtatgaagcagtccaccctgttcgt
aactggacggatatgaagcgcagagtcggcccatacagaagatgctatatgtttgctcac
agtgcaatgcctggagaaccactaattgtattacatgttgctctaatgcaaaatatttct
ggcagtatccaggcaattgtgaaagatattccttcttctgaggctgaagacggaaacaag
atacagtcagccatattttattctataagtttaacacagcaaggcctgcaaggagtggaa
cttgggaactaccttatcaagcgggtagtaaaggagctgcaggtagagttccctcagatt
ctagagttttcaagcctttctccaatcccgggctttacaaaatggctgttgggagctttg
agctctcagattaaagagtctggtagaacagagctgttcactgaagcagaatgcaaagaa
atagaggacattacaggaggaccgctttccgaatctttaaaacgtctttttacaagcagt
gaatggatgaggtgtgaaagacttgtgaatgctttagagacacctcttatgcggctttgt
gcttggtacctgtatggagaaaagcatcgaggctttgccctaaatccagttgctaacttt
catcttcaaaatggcgccgtcttgtggcgtcttaactggatggctgacaccagtcctcgt
ggaggaactgcttcctgtggaatgatggtgaattatcgctactttctggaaaacacaagc
gcaaacagtgctaaatacttgagaatgaaacacatagaggcctctgatcaagtcctgaat
ctggtgtctaagatgaacagtaaattatga

DBGET integrated database retrieval system