KEGG   Xenopus tropicalis (western clawed frog): 100145512Help
Entry
100145512         CDS       T01011                                 

Gene name
tymp
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    100145512 (tymp)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100145512 (tymp)
Enzymes [BR:xtr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     100145512 (tymp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 473 aa AA seqDB search
MELPSFPEQKDGLNLPFRIADIIAKKRDGLPLTAEEIKHVVQAATRGHAQDSQLGALLMA
VRLRGMDPEETLALTKEFVASGCVLQWPKEWSGILVDKHSTGGVGDKVSLPLAPALAACG
CKVPMISGRGLAHTGGTLDKLESIPGFSPEQSPAQMLEILRSVGCCIVGQSKDLVPADKI
FYEMRDVTATVDSLPLITASVISKKVAENVSALILDVKFGEAAQSPTLEEARILANSLVS
AGVSLGIPTSALVSNMDSPIGRCVGNTLEVIEALECMEGAGPDDLRELVMHTGGHLLWLC
GQASSETHGSEKIARALADGSALQCFRGMLEAQGVPSEIARTLSSTSNLRTASHQELLRV
EKSGTVKLIRAKPIAETLNALGAGRSRANDPINHSVGAELLVSMGQHVEQGDPWIRIHYE
NPQLQDEQRKYLQEAICIAEMPCFIPLPLIREIIPSQCEKEDVLAVRREGEIN
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggaattaccttcatttccagaacagaaagatggtttaaatttgccattccgtatcgct
gacatcattgctaagaagcgtgacggcttgccccttacagcagaagagattaaacatgtg
gtacaggcagctacaagaggccacgctcaggacagccaactgggtgctttgctcatggca
gtccgactccgtggaatggacccagaggagaccctagctctaaccaaggagtttgtggcc
tctgggtgtgttttacagtggccaaaggaatggagtggaattttggtggacaaacattct
acaggaggcgtgggggacaaagtcagcttgcctctggcaccagcacttgcggcttgtggc
tgcaaggtccctatgatcagtggcagagggctggcacatacaggtggaactttagacaag
ttggagtctattcctggtttcagccctgagcagagtcctgcacagatgttagagatccta
cgttcagtcgggtgctgtattgttggacagtctaaagatctggtgcctgctgataagatt
ttctatgagatgcgggatgtgacagcaacagtggacagtctgccactgattacagcatct
gttatcagcaagaaagttgctgagaatgtttcagcccttatcctggatgtgaagtttggt
gaagcagctcagagtccaaccctggaagaagcaaggattctggcaaatagccttgtcagt
gctggagtctctcttggtataccaacatctgccctagtctctaacatggatagtccaatt
ggccgttgtgtgggaaatacacttgaggtgatagaggcactagagtgcatggagggtgct
ggtccagatgaccttcgagaactggtgatgcatacaggtggtcatcttctctggctgtgt
ggtcaggcttcttcagaaacccatggttcagagaaaattgccagagctctggctgatggt
tcagctctgcaatgtttccgtggaatgctggaagcacaaggagtaccttctgaaatagca
aggacacttagctctactagtaatcttcgtacagcatcccatcaagagctgcttagggta
gaaaaatcaggaacagtgaagctgatccgagccaaacccattgcagagacactgaatgca
ttgggagctgggcgaagcagagccaatgatccaataaaccacagtgttggggctgagctc
ctggtgagcatgggccagcatgtagagcaaggagacccctggattagaattcactatgaa
aaccctcaactgcaagatgaacagagaaaatatcttcaagaagcaatttgcattgcagag
atgccttgtttcattcctctgccactgatcagggaaatcatcccttctcaatgcgagaaa
gaagatgtgcttgctgtgcgaagagaaggggagatcaactaa

DBGET integrated database retrieval system