KEGG   Xenopus tropicalis (western clawed frog): 100145512Help
Entry
100145512         CDS       T01011                                 

Gene name
tymp
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:xtr00240]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:xtr00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 473 aa AA seqDB search
MELPSFPEQKDGLNLPFRIADIIAKKRDGLPLTAEEIKHVVQAATRGHAQDSQLGALLMA
VRLRGMDPEETLALTKEFVASGCVLQWPKEWSGILVDKHSTGGVGDKVSLPLAPALAACG
CKVPMISGRGLAHTGGTLDKLESIPGFSPEQSPAQMLEILRSVGCCIVGQSKDLVPADKI
FYEMRDVTATVDSLPLITASVISKKVAENVSALILDVKFGEAAQSPTLEEARILANSLVS
AGVSLGIPTSALVSNMDSPIGRCVGNTLEVIEALECMEGAGPDDLRELVMHTGGHLLWLC
GQASSETHGSEKIARALADGSALQCFRGMLEAQGVPSEIARTLSSTSNLRTASHQELLRV
EKSGTVKLIRAKPIAETLNALGAGRSRANDPINHSVGAELLVSMGQHVEQGDPWIRIHYE
NPQLQDEQRKYLQEAICIAEMPCFIPLPLIREIIPSQCEKEDVLAVRREGEIN
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggaattaccttcatttccagaacagaaagatggtttaaatttgccattccgtatcgct
gacatcattgctaagaagcgtgacggcttgccccttacagcagaagagattaaacatgtg
gtacaggcagctacaagaggccacgctcaggacagccaactgggtgctttgctcatggca
gtccgactccgtggaatggacccagaggagaccctagctctaaccaaggagtttgtggcc
tctgggtgtgttttacagtggccaaaggaatggagtggaattttggtggacaaacattct
acaggaggcgtgggggacaaagtcagcttgcctctggcaccagcacttgcggcttgtggc
tgcaaggtccctatgatcagtggcagagggctggcacatacaggtggaactttagacaag
ttggagtctattcctggtttcagccctgagcagagtcctgcacagatgttagagatccta
cgttcagtcgggtgctgtattgttggacagtctaaagatctggtgcctgctgataagatt
ttctatgagatgcgggatgtgacagcaacagtggacagtctgccactgattacagcatct
gttatcagcaagaaagttgctgagaatgtttcagcccttatcctggatgtgaagtttggt
gaagcagctcagagtccaaccctggaagaagcaaggattctggcaaatagccttgtcagt
gctggagtctctcttggtataccaacatctgccctagtctctaacatggatagtccaatt
ggccgttgtgtgggaaatacacttgaggtgatagaggcactagagtgcatggagggtgct
ggtccagatgaccttcgagaactggtgatgcatacaggtggtcatcttctctggctgtgt
ggtcaggcttcttcagaaacccatggttcagagaaaattgccagagctctggctgatggt
tcagctctgcaatgtttccgtggaatgctggaagcacaaggagtaccttctgaaatagca
aggacacttagctctactagtaatcttcgtacagcatcccatcaagagctgcttagggta
gaaaaatcaggaacagtgaagctgatccgagccaaacccattgcagagacactgaatgca
ttgggagctgggcgaagcagagccaatgatccaataaaccacagtgttggggctgagctc
ctggtgagcatgggccagcatgtagagcaaggagacccctggattagaattcactatgaa
aaccctcaactgcaagatgaacagagaaaatatcttcaagaagcaatttgcattgcagag
atgccttgtttcattcctctgccactgatcagggaaatcatcccttctcaatgcgagaaa
gaagatgtgcttgctgtgcgaagagaaggggagatcaactaa

DBGET integrated database retrieval system