KEGG   Xenopus tropicalis (western clawed frog): 100145520Help
Entry
100145520         CDS       T01011                                 

Gene name
prkaa1, ampk, ampka1
Definition
(RefSeq) protein kinase, AMP-activated, alpha 1 catalytic subunit
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04068  FoxO signaling pathway
xtr04140  Autophagy - animal
xtr04150  mTOR signaling pathway
xtr04371  Apelin signaling pathway
xtr04530  Tight junction
xtr04910  Insulin signaling pathway
xtr04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    100145520 (prkaa1)
   04068 FoxO signaling pathway
    100145520 (prkaa1)
   04150 mTOR signaling pathway
    100145520 (prkaa1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100145520 (prkaa1)
  Cellular community - eukaryotes
   04530 Tight junction
    100145520 (prkaa1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100145520 (prkaa1)
   04920 Adipocytokine signaling pathway
    100145520 (prkaa1)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100145520 (prkaa1)
Protein kinases [BR:xtr01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   100145520 (prkaa1)
Membrane trafficking [BR:xtr04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100145520 (prkaa1)
Mitochondrial biogenesis [BR:xtr03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100145520 (prkaa1)
  Mitophagy factors
   Other mitophagy factors
    100145520 (prkaa1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr AdenylateSensor Kinase-like RIO1 Kdo APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 100145520
NCBI-ProteinID: NP_001120434
Xenbase: XB-GENE-946195
UniProt: B1H2Z8
Position
1
AA seq 551 aa AA seqDB search
MAADKQKHHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVV
GKIRREIQNLKLFRHPHIIKLYQVISTPTDIFMVMEYVSGGELFDYICKNGKLDEKESRR
LFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMADGEFLRTSCGSPN
YAAPEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLN
PPVISLLKHMLLVDPMKRATIKDIREHEWFKLDLPKYLFPEDPSYSSNMIDDEALKEVCE
KCECLEEEVLSCLYSRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDSFMEEPQVAR
PHPERVPFLVAESPRQRHTLDELNPQKTKHQVGVRRAKWHLGIRSQSRPNDIMAEVCRAM
KQLGYEWKVVNPYYLRVRRKNPVTSMYTKMSLQLYQVDSRTYLLDFRSIDDEVTEAKSES
ATPRRSGSISNYRPPKNDSDPEIQAKSSDGSGPSSLTSSVDSSNADLVPRPGSHTIEFFE
MCANLIKILAR
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggataaacagaagcatcatgacgggagggtgaagatcggtcactatatactg
ggcgacacgctcggggtgggcacgtttggcaaagtgaaagttggcaagcatgagcttaca
gggcacaaggtcgccgtgaagattttaaaccggcagaagatccgcagccttgacgtggtt
gggaaaattcgccgtgagatccagaatctgaagctcttcagacatcctcatatcattaag
ctgtaccaggtcatcagcacaccaacagatatctttatggttatggaatatgtttctggc
ggggaactatttgattatatatgtaagaatgggaagttggatgaaaaagaatcccggcgc
ttattccagcaaattctttccggggttgattattgccatagacatatggtcgtacaccga
gacttgaagcctgagaatgttcttcttgatgcccacatgaatgcgaagattgcggatttt
gggctctctaacatgatggctgatggtgaattcctacgaaccagctgcggttcccctaat
tacgctgctccggaagttatctcaggaaggctttatgctggcccagaggtggacatatgg
agctgcggggtcatcctgtatgcgttactctgtggaactctcccttttgatgatgatcat
gtgccaacactttttaagaagatatgtgatggcatcttctacacaccccagtacctgaac
cctcccgtcattagccttctaaagcacatgctgctggtggatcccatgaaaagggcaacc
atcaaagatattcgggaacatgaatggttcaagctagatcttcctaaatatctgtttccc
gaggatccatcgtacagttccaatatgatagacgacgaagccttaaaagaagtgtgtgag
aagtgcgagtgcttggaggaggaagtgctgagctgcttgtacagtcgcaaccaccaggac
ccgttggcagtcgcctaccatctgatcatagataatcgccgcataatgaatgaggccaaa
gacttctatttggctaccagccctccggattcctttatggaagagcctcaagttgctcgg
cctcacccagagagagttccctttttagtggccgagtcaccccggcaacgacacactctc
gatgagttaaacccacaaaagaccaaacaccaggttggtgtgagaagagccaaatggcat
ttaggcattcgaagtcagagccgcccaaacgatatcatggcagaggtttgccgagcaatg
aaacagctgggctatgagtggaaggttgtaaatccatactacctgcgcgtaagaaggaag
aatcccgttactagcatgtacactaagatgagcctccagctgtaccaagtggatagcaga
acttacctgctggatttccgcagcattgacgatgaagtaactgaggccaagtcggaaagc
gccacccctaggcgatcaggctccattagcaattatcgacctccaaaaaatgactcggat
cctgaaattcaagcgaagtcttcagacggctcagggccttcatctttaacctcatcagtg
gactcttccaatgccgacctagtccccaggccaggaagccataccatagaattttttgaa
atgtgtgcaaatttaataaaaatccttgcacgatag

DBGET integrated database retrieval system