KEGG   Xenopus tropicalis (western clawed frog): 100145520Help
Entry
100145520         CDS       T01011                                 

Gene name
prkaa1, ampk, ampka1
Definition
protein kinase, AMP-activated, alpha 1 catalytic subunit
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100145520 (prkaa1)
   04150 mTOR signaling pathway
    100145520 (prkaa1)
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    100145520 (prkaa1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100145520 (prkaa1)
   04920 Adipocytokine signaling pathway
    100145520 (prkaa1)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100145520 (prkaa1)
Protein kinases [BR:xtr01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   100145520 (prkaa1)
Mitochondrial biogenesis [BR:xtr03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100145520 (prkaa1)
  Mitophagy factors
   Other mitophagy factors
    100145520 (prkaa1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 551 aa AA seqDB search
MAADKQKHHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVV
GKIRREIQNLKLFRHPHIIKLYQVISTPTDIFMVMEYVSGGELFDYICKNGKLDEKESRR
LFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMADGEFLRTSCGSPN
YAAPEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLN
PPVISLLKHMLLVDPMKRATIKDIREHEWFKLDLPKYLFPEDPSYSSNMIDDEALKEVCE
KCECLEEEVLSCLYSRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDSFMEEPQVAR
PHPERVPFLVAESPRQRHTLDELNPQKTKHQVGVRRAKWHLGIRSQSRPNDIMAEVCRAM
KQLGYEWKVVNPYYLRVRRKNPVTSMYTKMSLQLYQVDSRTYLLDFRSIDDEVTEAKSES
ATPRRSGSISNYRPPKNDSDPEIQAKSSDGSGPSSLTSSVDSSNADLVPRPGSHTIEFFE
MCANLIKILAR
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggataaacagaagcatcatgacgggagggtgaagatcggtcactatatactg
ggcgacacgctcggggtgggcacgtttggcaaagtgaaagttggcaagcatgagcttaca
gggcacaaggtcgccgtgaagattttaaaccggcagaagatccgcagccttgacgtggtt
gggaaaattcgccgtgagatccagaatctgaagctcttcagacatcctcatatcattaag
ctgtaccaggtcatcagcacaccaacagatatctttatggttatggaatatgtttctggc
ggggaactatttgattatatatgtaagaatgggaagttggatgaaaaagaatcccggcgc
ttattccagcaaattctttccggggttgattattgccatagacatatggtcgtacaccga
gacttgaagcctgagaatgttcttcttgatgcccacatgaatgcgaagattgcggatttt
gggctctctaacatgatggctgatggtgaattcctacgaaccagctgcggttcccctaat
tacgctgctccggaagttatctcaggaaggctttatgctggcccagaggtggacatatgg
agctgcggggtcatcctgtatgcgttactctgtggaactctcccttttgatgatgatcat
gtgccaacactttttaagaagatatgtgatggcatcttctacacaccccagtacctgaac
cctcccgtcattagccttctaaagcacatgctgctggtggatcccatgaaaagggcaacc
atcaaagatattcgggaacatgaatggttcaagctagatcttcctaaatatctgtttccc
gaggatccatcgtacagttccaatatgatagacgacgaagccttaaaagaagtgtgtgag
aagtgcgagtgcttggaggaggaagtgctgagctgcttgtacagtcgcaaccaccaggac
ccgttggcagtcgcctaccatctgatcatagataatcgccgcataatgaatgaggccaaa
gacttctatttggctaccagccctccggattcctttatggaagagcctcaagttgctcgg
cctcacccagagagagttccctttttagtggccgagtcaccccggcaacgacacactctc
gatgagttaaacccacaaaagaccaaacaccaggttggtgtgagaagagccaaatggcat
ttaggcattcgaagtcagagccgcccaaacgatatcatggcagaggtttgccgagcaatg
aaacagctgggctatgagtggaaggttgtaaatccatactacctgcgcgtaagaaggaag
aatcccgttactagcatgtacactaagatgagcctccagctgtaccaagtggatagcaga
acttacctgctggatttccgcagcattgacgatgaagtaactgaggccaagtcggaaagc
gccacccctaggcgatcaggctccattagcaattatcgacctccaaaaaatgactcggat
cctgaaattcaagcgaagtcttcagacggctcagggccttcatctttaacctcatcagtg
gactcttccaatgccgacctagtccccaggccaggaagccataccatagaattttttgaa
atgtgtgcaaatttaataaaaatccttgcacgatag

DBGET integrated database retrieval system