KEGG   Xenopus tropicalis (western clawed frog): 100145520Help
Entry
100145520         CDS       T01011                                 

Gene name
prkaa1, ampk, ampka1
Definition
protein kinase, AMP-activated, alpha 1 catalytic subunit
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:xtr04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:xtr04150]
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:xtr04140]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:xtr04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:xtr04920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 551 aa AA seqDB search
MAADKQKHHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVV
GKIRREIQNLKLFRHPHIIKLYQVISTPTDIFMVMEYVSGGELFDYICKNGKLDEKESRR
LFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMADGEFLRTSCGSPN
YAAPEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLN
PPVISLLKHMLLVDPMKRATIKDIREHEWFKLDLPKYLFPEDPSYSSNMIDDEALKEVCE
KCECLEEEVLSCLYSRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDSFMEEPQVAR
PHPERVPFLVAESPRQRHTLDELNPQKTKHQVGVRRAKWHLGIRSQSRPNDIMAEVCRAM
KQLGYEWKVVNPYYLRVRRKNPVTSMYTKMSLQLYQVDSRTYLLDFRSIDDEVTEAKSES
ATPRRSGSISNYRPPKNDSDPEIQAKSSDGSGPSSLTSSVDSSNADLVPRPGSHTIEFFE
MCANLIKILAR
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggataaacagaagcatcatgacgggagggtgaagatcggtcactatatactg
ggcgacacgctcggggtgggcacgtttggcaaagtgaaagttggcaagcatgagcttaca
gggcacaaggtcgccgtgaagattttaaaccggcagaagatccgcagccttgacgtggtt
gggaaaattcgccgtgagatccagaatctgaagctcttcagacatcctcatatcattaag
ctgtaccaggtcatcagcacaccaacagatatctttatggttatggaatatgtttctggc
ggggaactatttgattatatatgtaagaatgggaagttggatgaaaaagaatcccggcgc
ttattccagcaaattctttccggggttgattattgccatagacatatggtcgtacaccga
gacttgaagcctgagaatgttcttcttgatgcccacatgaatgcgaagattgcggatttt
gggctctctaacatgatggctgatggtgaattcctacgaaccagctgcggttcccctaat
tacgctgctccggaagttatctcaggaaggctttatgctggcccagaggtggacatatgg
agctgcggggtcatcctgtatgcgttactctgtggaactctcccttttgatgatgatcat
gtgccaacactttttaagaagatatgtgatggcatcttctacacaccccagtacctgaac
cctcccgtcattagccttctaaagcacatgctgctggtggatcccatgaaaagggcaacc
atcaaagatattcgggaacatgaatggttcaagctagatcttcctaaatatctgtttccc
gaggatccatcgtacagttccaatatgatagacgacgaagccttaaaagaagtgtgtgag
aagtgcgagtgcttggaggaggaagtgctgagctgcttgtacagtcgcaaccaccaggac
ccgttggcagtcgcctaccatctgatcatagataatcgccgcataatgaatgaggccaaa
gacttctatttggctaccagccctccggattcctttatggaagagcctcaagttgctcgg
cctcacccagagagagttccctttttagtggccgagtcaccccggcaacgacacactctc
gatgagttaaacccacaaaagaccaaacaccaggttggtgtgagaagagccaaatggcat
ttaggcattcgaagtcagagccgcccaaacgatatcatggcagaggtttgccgagcaatg
aaacagctgggctatgagtggaaggttgtaaatccatactacctgcgcgtaagaaggaag
aatcccgttactagcatgtacactaagatgagcctccagctgtaccaagtggatagcaga
acttacctgctggatttccgcagcattgacgatgaagtaactgaggccaagtcggaaagc
gccacccctaggcgatcaggctccattagcaattatcgacctccaaaaaatgactcggat
cctgaaattcaagcgaagtcttcagacggctcagggccttcatctttaacctcatcagtg
gactcttccaatgccgacctagtccccaggccaggaagccataccatagaattttttgaa
atgtgtgcaaatttaataaaaatccttgcacgatag

DBGET integrated database retrieval system