KEGG   Xenopus tropicalis (western clawed frog): 100145558Help
Entry
100145558         CDS       T01011                                 

Gene name
mapk15
Definition
mitogen-activated protein kinase 15 (EC:2.7.11.24)
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 590 aa AA seqDB search
MSGPEVEDHISQKYEIKKRLGKGAYGIVWKAIDRKSGEIVAVKKIFDAFRNRTDAQRTFR
EIMFLQEFGEHPNIIKLLNVIRAQNDKDIYLVFEHMETDLHAVIKKGNLLRDIHMRYILY
QLLKATKFIHSGNVIHRDQKPSNILLDGDCLVKLCDFGLARSLYQIQEDAGNPALTEYVA
TRWYRAPEILLASHRYTKGVDMWSVGCILGEMLLGKPLFPGTSTINQIERIMSIIEPPTH
EDILAIRSEYGASVIGRMAAKQRVPLAELFPASCPREALDLLSKLLVFNPGKRLTAEGAL
EHPYVSRFHSPAREPALDYDVILPVDDDTQLSVAEYRNKLYEMILERKMNIRRQKREAQK
ESVSSLASAAEGKQVADTSKHPAAPTGTNPAPQEISSTVPQRAAIAAPNQPPALKDSTQQ
SPKGKAPSSNPISHSTTHGSSEDWRAAQNRKEGQQNSNQQGAAGSTAQEVRKEAESRSRT
APIGRARSFSHSQQARAAATNSALMRKDGAPLGTVSVAAVSARLNQRAPPVQSRDQRSAP
RFGRKMFQGKTNVESAGDPKATLHSYTQAYGTISKSALHNLPQGSAFKGK
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcccagaggtggaggatcacatctcccagaaatatgagatcaaaaagcgactg
ggaaagggcgcatacggaattgtatggaaagctattgatcgcaaatctggagaaattgtt
gctgtgaaaaaaatctttgatgctttccggaatcgcacggatgctcagagaacttttcgt
gaaatcatgttcctgcaggagttcggggagcacccaaacatcatcaagttgctaaatgtc
attcgagctcagaacgataaggatatttacctggtgtttgagcacatggagacagaccta
cacgcagtgataaagaaggggaacctgctgagagacatccatatgagatacatcctctac
caactgctcaaggcaaccaagtttatccactccggcaatgtcattcatagggaccaaaag
ccctctaacatcctgctggacggggactgcctggtgaaactgtgtgacttcggcctcgcg
cgctcgctctatcagatccaggaggatgcggggaacccggcacttacagaatatgtcgct
actcgttggtacagagccccagagatcctgctggcatcccaccggtacactaagggtgtg
gatatgtggagtgtgggctgcatcctgggggagatgttgcttgggaaacccctttttcca
ggaacgtctactatcaaccagattgagcggattatgagcataattgagccccccactcat
gaagatattctggctataaggtcggagtacggcgcatcagtgattggcaggatggcggct
aagcagagggtgcccctggcagagctgttcccggcaagttgccccagggaagcccttgac
ctgctgagtaaacttctagtcttcaacccggggaaaagacttacagcagagggggctctg
gaacatccgtatgtcagcagattccactccccggcccgggaacctgcattggattacgat
gttattctcccagtggacgatgacacccagttgtctgtggctgaatatcggaacaaactg
tatgagatgattcttgagaggaaaatgaacattcgaagacagaaacgagaagcacaaaaa
gaaagcgtaagctctttggccagtgctgcagaaggcaaacaggttgcagatacttcaaaa
catccagcagccccaacaggcaccaaccctgcaccccaagaaatttcctccactgttccc
caaagagctgccattgctgctcccaaccaacccccagcgctaaaggacagcacccaacag
agcccaaagggcaaagcaccttcttccaaccccataagccacagcaccacccacggtagc
tcagaggactggcgggcagcacagaacaggaaggagggccaacagaacagcaaccagcag
ggggcagcaggttccactgcacaggaggtcaggaaggaggcggagtcacgaagcaggaca
gctcccattggtagagcgcgttctttctctcacagccaacaggctcgagctgcagcaacc
aacagcgccctgatgcgtaaggatggcgcccccttgggtacagtgagtgtcgctgcagtc
agtgccagactgaaccagcgtgctcccccggtacaaagccgagaccagcgttctgccccc
aggtttggcagaaagatgtttcaggggaaaacaaatgtggaatccgcgggggaccccaaa
gccactctgcacagttacacacaggcctatggcaccatcagcaaatccgccctgcacaac
ctgccccagggaagcgccttcaagggcaaataa

DBGET integrated database retrieval system