KEGG   Xenopus tropicalis (western clawed frog): 100145598Help
Entry
100145598         CDS       T01011                                 

Gene name
ppp1ca, ppp1a
Definition
protein phosphatase 1, catalytic subunit, alpha isozyme (EC:3.1.3.16)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
mRNA surveillance pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Focal adhesion
Regulation of actin cytoskeleton
Insulin signaling pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    100145598 (ppp1ca)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100145598 (ppp1ca)
  Cell growth and death
   04114 Oocyte meiosis
    100145598 (ppp1ca)
  Cellular commiunity
   04510 Focal adhesion
    100145598 (ppp1ca)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100145598 (ppp1ca)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100145598 (ppp1ca)
   04270 Vascular smooth muscle contraction
    100145598 (ppp1ca)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    100145598 (ppp1ca)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100145598 (ppp1ca)
Protein phosphatases and associated proteins [BR:xtr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100145598 (ppp1ca)
Transcription machinery [BR:xtr03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100145598 (ppp1ca)
Spliceosome [BR:xtr03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100145598 (ppp1ca)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 326 aa AA seqDB search
MGDGEKLNIDSIIQRLLEVKGCRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDL
QSMEQVRRILRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGADVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGSMMSVDESLMCSFQILKPAD
KKLFAYGGVNQSRPVTPPRNKNKQSK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgggggacggagaaaaactcaatattgactccattatccaacggctcctggaggttaaa
ggctgccgccctgggaagaatgttcagctgacggagaatgagatccgggggctgtgcctg
aagtcccgcgagatcttcctcagccagccaatcctgttggagctggaggccccgctgaag
atctgcggggatgtgcacggtcagtactacgacctgctgcgcctgtttgagtatgggggc
ttcccccccgagagtaactacctgttcctgggggattacgtggatcgggggaagcagtcg
ctggagaccatctgcctgctgctcgcctacaagatcaagtaccccgagaacttcttcctg
ctgcgcgggaaccacgagtgcgccagcatcaaccgcatctacggcttctacgatgagtgt
aagcggcgctacaacattaagctgtggaaaaccttcaccgactgcttcaactgcctgccc
gtggccgccatcgtggatgagaagatcttctgctgccacgggggcctctcccccgaccta
cagtccatggagcaagtcagacggatcctgcgtcccaccgatgtaccggaccaggggctc
ctgtgtgacctgttgtggtcggacccggacaaagatgttcttgggtggggggagaacgac
cgcggggtctccttcacctttggggctgatgtagtagcaaaatttcttcacaaacatgac
cttgacctcatctgccgagctcaccaggtggtagaggacggctatgagttcttcgctaag
cggcagctggtgacgctcttctcggcgcccaattactgcggggagtttgacaacgcgggt
tccatgatgagtgtggacgagtccctcatgtgctcctttcagatcttgaaacctgcggat
aagaaactttttgcttacgggggcgtcaaccagagccgccccgtgacccccccgcgcaac
aagaacaaacagtctaaatga

DBGET integrated database retrieval system