KEGG   Xenopus tropicalis (western clawed frog): 100145633Help
Entry
100145633         CDS       T01011                                 

Gene name
pom121
Definition
POM121 membrane glycoprotein
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100145633 (pom121)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 1054 aa AA seqDB search
MEGGCCWDLAKRIQPIALPLALSLVTCALAYIYNQLTVAGLLLASCWTYRSSGRRFLLWK
WLKSRKLVPGTKKLSRKTEWKLQSPSVSLLEGSPSPLPLNMGTYMGKQEFPGRGEVCGPR
AIKEKLSRPNPSVPTPTRRLSFRDPLSSSQRTYLCARRDYPLKQEIYNKPGSLPRVCLDG
QQQQKMQLTPRHFTRRTPVKISPQGLKTKFHFDTAPEPNILSPSRLDLEKVPYLPSVRHH
IDLETSVTHSHHLSEPEQYPTSPSRSKADTSVATFSSHHKEDPCATESVLKALRECLKRK
RIKDDDSEDTENKRRKEHGEESKLVVNGSFCGSSKMEASRASWRSQSSSMENLSQQSSIS
IQDILREVPSSKNSDGKLSPASSSSLENLSKRKIITVPGHNEITSSLSSSRYHLQKKKRS
MDTPRCETPDWPIKKMRKDRLETSMSPSQETMKTQISEAQRVEANPSPVQLHKPRGNLPW
KRHVHLICPEHPDEFYRLPPGPIPGYSVTQADYDAAKEAAQQRFLKLFQEPSAPSVPSAP
ETRVSLTSQTSNLPDKSFPAGNDKPNTSAANTTFTLFSSTSDAKSVTASSTTPLLFSTVT
TSGTSSLQSLGSGQTKSESQYPKNGLFQVLGKPEGSNNNQPMFNPVFGPSESVNPSPVTA
APGLSTTTATTLKPICEDPRSQQAQTSMFKPIFEAPSSQTAPSALTSPFVFSSSTSTTSS
SFLGTTGNSTVTGKQEKPNLAVTTCTSNAISSSSVPTFGITKADPVSQGGPTSQANTNFG
FIGSTSVPAISTAFGSTTSAFTATVGSTANNTFPRNTAPTGASSISGSEAQTSISTTNSF
PKFGVSVGQNVFSASNPFGSGTQSTTGTSIQSATNANFSFVGSTSASTQPTFGFSHNTSM
PFGSGTKSSNTSNSSGFSAVGSVFGSATVPPSSIVTPNKSSSIILGTPEKCETKNQLVTN
QIPLGQGLTPAPFQSIMPTQSFTSSSTPFAPSTPTANQSSTPSSFPSMTAGQNFTSPGNN
LSPAAGFFSHGTAPKTRTAVRHKLHPRRPHPRKK
NT seq 3165 nt NT seq  +upstreamnt  +downstreamnt
atggaagggggctgttgctgggatttggctaagcgaatacagcccattgcactgcctttg
gccttgtcccttgtaacctgcgctttggcatatatatataatcaacttacagtggccggc
ctccttctagccagctgctggacctacaggagctctgggaggcggttccttctgtggaag
tggctcaaaagccgaaaactagttccgggcaccaaaaagctgagcaggaaaactgagtgg
aagctgcagagtccttctgtatccctgctggagggaagcccgtctcccctgcctctcaac
atgggcacctacatgggcaagcaagagtttcctggcaggggagaggtgtgcgggcccaga
gccattaaggagaagctgagtagacccaatccatcggtgccaacccctaccaggcgtctg
tcattcagggatccactgtcttcatctcaacgaacctatttgtgtgctcgaagggattat
cctcttaaacaagaaatttataacaagccaggatctctcccaagggtttgtttagatgga
caacagcagcagaaaatgcaattgacacccagacacttcactaggaggactcctgtgaaa
atttccccgcagggtctgaaaaccaaatttcattttgacaccgctccagagccaaatatt
ttatcgccctctcgtcttgacttggagaaagtaccatatttgccttccgtccgccatcac
atagacctggaaaccagtgtgacgcattctcaccatctatcggaaccagagcagtatcca
acatccccctcaagatctaaagcagacacttctgtagcaactttctccagtcatcacaag
gaagatccatgcgctacggagtctgtacttaaagcccttagagagtgcttaaagagaaag
agaattaaagacgatgactctgaagatactgaaaacaagagaaggaaggaacatggggaa
gaaagtaagctggttgtgaatggttccttttgcggaagctctaaaatggaagccagccgg
gcaagttggaggtctcaatccagttctatggagaacctgtcccaacagtcatccatttca
attcaggacatcttaagagaggtaccctcttccaaaaacagtgacggcaaactctcacct
gcctcctcatccagtttggagaatttatcaaaacgaaagattatcacggtgcctggtcat
aatgaaatcactagctccttaagctccagcagatatcacctgcagaaaaagaagcgatct
atggatactcccagatgtgagacacccgattggccaataaaaaaaatgagaaaagaccga
ctggaaacttctatgtcaccttctcaagaaacaatgaaaacccaaatttctgaagcacag
agagtcgaggcaaacccttctccggtacagctgcataagcctaggggaaatttgccatgg
aaacgccatgtccacctcatttgcccagaacaccccgatgagttctacagattacctcct
ggaccaataccaggctacagcgtgacgcaggctgattatgatgcagccaaagaggcagca
cagcagaggtttcttaaactattccaggagccatctgcaccatctgttccttctgcccct
gagacacgggtatctctgacatcacagacctcaaatctccctgacaaatcttttccagct
ggaaatgataaaccaaacacttctgcagcaaacactacgtttacccttttttcaagtact
tctgatgcaaaatcagttactgcttccagtacaacacccttgcttttttctactgttact
acatctggaaccagcagccttcagtcactgggatcaggtcaaacaaaatcagagtctcag
tatccaaagaatggtctttttcaggttcttggcaagccagagggaagtaataacaatcag
cctatgtttaacccagtatttggaccttcagagagtgtaaatccttcccctgttactgca
gctcctggtctctcgacaaccacagcaaccacactcaaaccaatatgtgaggatccacgt
agccagcaagctcagacttctatgtttaaaccaatatttgaggctcccagtagccagaca
gctccgtcagctctaacctctccattcgtgtttagcagctccacctccactacctcatca
tcttttctcggtaccacaggaaatagcaccgttacaggcaagcaggaaaaaccaaacttg
gctgtaacaacctgcactagtaacgccattagttccagttcagtacccacatttggaatt
acaaaggctgatcctgtttctcaagggggacctacttcacaggcaaatacaaatttcggt
tttattggcagtacatcagtacctgctatatcaacagcatttggatccaccacatctgca
tttactgctacagttggtagcactgcaaataatacatttccgcgcaacactgccccgact
ggtgcttccagcatctctggaagtgaagcacaaactagcatatccacaactaactccttc
ccaaaatttggagtatccgtaggacaaaatgtgttttctgctagcaacccctttggaagc
ggtacccaatctacaacgggcaccagtatacaatctgcaacaaacgccaactttagtttt
gtcggcagcacttcagcatccactcagcctacgtttggtttttcacataacacatccatg
ccttttggcagtggtacaaaaagcagtaacacttctaactcaagtggtttcagtgctgtg
ggatctgtatttgggagtgcaactgtccctccatctagtattgttactccaaacaagagc
tcatccatcatcttaggaaccccagagaaatgcgaaactaaaaaccagttggtaacaaac
cagattccgttgggtcagggcttgactccagcaccgtttcaatctataatgccaacgcaa
agctttacaagctcgagtactccatttgcaccaagtacaccaacagcgaaccagagttcc
accccaagctcttttccatctatgactgcagggcaaaactttacaagtcctggcaacaac
ctcagtcctgctgctggctttttttcccatggtactgcacctaaaactagaacagcagtt
cgacataaactgcatccacgtcggccacatcctcgtaagaagtaa

DBGET integrated database retrieval system