KEGG   Xenopus tropicalis (western clawed frog): 100145767Help
Entry
100145767         CDS       T01011                                 

Gene name
gla
Definition
galactosidase, alpha
Orthology
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100145767 (gla)
  Lipid metabolism
   00561 Glycerolipid metabolism
    100145767 (gla)
   00600 Sphingolipid metabolism
    100145767 (gla)
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    100145767 (gla)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100145767 (gla)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     100145767 (gla)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 408 aa AA seqDB search
MDYAWLSVLLGTVLWPQGAQSLQNGLALTPPMGWLHWERFLCETNCERNPKNCISEQLFM
DMADKMVSEGWLDAGYQYLCIDDCWLAPERDEKNRLQADPVRFPGGIKKLADYVHSRGLL
LGIYEDVGSKTCEGFPGSQGYYDIDAQTFAEWGVDLLKFDGCYYGTLDKLEDGYRQMSMA
LNRTGRKIVLSCEWPLYERGIKKINYSEVAEYCNSWRNFGDITDSWGSVKAVMDLSSAVQ
EEIVPVAGPGSWNDPDMLVIGNFGLSWNQQVTQMALWSIMAAPLMMSNDLRDIPAESKAL
LQDKNVISINQDPLGAQGYRVFKADYFEVWERPLIKGSLAVAVTNRNEIGGPRNFLLSLS
LLWEDRVCQNSCFITQLLPSFQKYGHLNDTSLLSLWINPSGTILLRID
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggattatgcttggctgtcagtacttctgggaactgtgctgtggccccaaggggcccaa
agcttgcagaatgggctagcactcacacctcctatgggatggctccactgggagaggttt
ctgtgtgagaccaattgtgagaggaaccccaagaactgtataagtgaacagctgttcatg
gacatggctgacaagatggtgtctgaaggctggctggatgcaggatatcaatacttgtgt
attgatgattgctggttggctccagaaagagatgaaaaaaacaggcttcaagctgaccct
gtgcgattcccagggggtattaagaagctagctgactatgttcattctcgtggattactt
ctgggaatttacgaagatgtgggaagtaaaacatgtgaagggtttccaggaagccagggt
tattatgacatagatgcacagacctttgctgaatggggggtggatctgctaaaatttgat
ggttgctactatgggacactggacaaactggaggatggatatcgccaaatgtctatggca
ctgaatcgcactgggagaaagattgtgctttcctgtgaatggcctttatacgaacggggt
ataaagaagatcaattactctgaagttgctgaatactgcaattcttggaggaatttcggt
gacatcacagactcctgggggagtgtaaaggctgtgatggacttgagctctgctgtgcag
gaggaaattgtccctgtggctggtcctgggtcatggaatgatccagacatgctggtgatt
ggcaattttggtttgagctggaaccagcaagtcacacagatggcactctggtccatcatg
gctgcccctctcatgatgtccaacgacctgagagatattcctgctgagtccaaagctctt
ctccaggacaaaaatgtgatctccattaaccaagatcctcttggagcacaaggatacaga
gttttcaaggctgattattttgaagtgtgggaaaggcctctcatcaaaggatctctggct
gttgctgtgaccaatcgcaatgaaataggtggccctaggaatttcctgttgtcactttct
ctgctgtgggaagacagggtttgccagaacagttgctttattactcaacttctgccttcc
ttccaaaagtacggtcacctgaatgacacttccctgctgtcactctggattaacccttct
ggaaccatattgctcaggatagactga

DBGET integrated database retrieval system