KEGG   Xenopus tropicalis (western clawed frog): 100145783Help
Entry
100145783         CDS       T01011                                 

Gene name
abhd6, abhd6-a, abhd6-b
Definition
(RefSeq) abhydrolase domain containing 6
  KO
K13700  
abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100145783 (abhd6)
Peptidases [BR:xtr01002]
 Serine Peptidases
  Family S33
   100145783 (abhd6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 338 aa AA seqDB search
MDIDVLNMFLVAGGTLLVPILAFVTSFLLWPAALINIYYWYWRRALGMQVKYSSYGNYQF
CYTSRGKPGNKPSVLMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSPLDDYS
ISGQVKRIHQFVESIGLNKKPFHLVGTSMGGNVAGVYAAQYPTDISSLTLICPAGLDYPN
DSTFLKHLKGLEKSSPDDQRIPLIPSTATEMQEMLRLCSFVRFKIPQQVLQGLVDVRIPH
NEFYRRLFLALVDEKSRHSLHENMGKIVAPTQIIWGKQDQVLDVSGTEVLAGSIRGCQVE
ILENCGHSVVMERPRKSAKLMADFLSSLQSTENNKKHD
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggatatagacgtactgaacatgttcctggtggcgggggggaccctccttgtccctata
ttggcctttgtgacctccttcctcctctggccggccgcactcatcaacatttattactgg
tactggcgccgggccctcgggatgcaggttaaatactccagctatgggaactaccagttc
tgctacacgtcccgcgggaagccgggcaacaagccctccgtcctgatgctccatggattc
tccgcgcataaagacatgtggctgtcggtggttaagttccttcccaagaacctgcacctg
gtgtgtgtggatatgccaggccacgagggcaccacgcgctcaccattagatgactactcc
atcagcgggcaagttaagcggatacaccagtttgtggaaagcatcgggctgaacaagaag
cctttccatttggtcggtacctcgatgggggggaatgtcgctggcgtttacgctgcccag
tacccaaccgacatcagcagcctgacccttatctgtcctgcaggcttggattatccaaac
gatagcacattcctgaaacacctgaagggcctggagaaatccagtccagacgaccagagg
atcccgctcatcccgtccacagcaacagaaatgcaggagatgctgcgactctgctcgttt
gttcgcttcaagatcccacagcaggtcctgcaggggctcgttgatgtgcgcattccccat
aatgaattttacagaagactatttttggctcttgtcgacgagaagtcgaggcacagtttg
catgaaaacatgggcaaaattgtggctcccacccaaataatctggggcaaacaagaccag
gttctggatgtatctggcactgaagttttggccggttctatccgcgggtgccaggtagag
attctggagaactgcgggcactccgtagtgatggaacggcccaggaagagcgccaaactc
atggcggacttcttgtcttcccttcagagcacagagaacaataagaaacacgattaa

DBGET integrated database retrieval system