KEGG   Xenopus tropicalis (western clawed frog): 100158519Help
Entry
100158519         CDS       T01011                                 

Gene name
pik3cg, pi3k
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma
  KO
K21289  
phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Inositol phosphate metabolism
Adrenergic signaling in cardiomyocytes
Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100158519 (pik3cg)
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    100158519 (pik3cg)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100158519 (pik3cg)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100158519 (pik3cg)
Membrane trafficking [BR:xtr04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100158519 (pik3cg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
3
AA seq 1110 aa AA seqDB search
MELDSYEQPVVLRDENQRRRRRMRPHSATSNMFPMEQIPIEFILPTSNRCSKVQETMLLE
VAGNCSVEQMKAQIWMHAIEKSHNSDFYQRLTPDQFLLQYQKKGQWYEIYDKHQVIQTLD
CIMYWKVLQKTVGKIHIVQKEKIPEEMIEYQKTLNYLIGYDVTDVSNVHDDELEFTRRRL
VTPRMIELSRRDARLYSMDPWVTCKSLPEYLCQRIISNSIFIIIHKGMTSHTIRVSIDDT
PDVILHSFFTKMAKKKSLLDISEENSELDFVLRVCGRDEYIIGNAPIKDFHWIRQCIKNG
QEIHLVLEKPPDPLMDEVQKEQWPLVDDCTGVTGYHEQLTIEGKDHEKIFTISLWDCNRK
FRVKIIGIDIPVLPKNTELIAFVEANIQHGQQVLSQRRTTCKPFTEEVLWNSWLEFDIKI
KDLPKGALLNLQIFCGKAPTASNKSIVQSPESTASDSKCKNQLLYYVNLLLIDHRFLLRQ
GEYVLHMWKIPGKGEEQGSINADKLTSATNPDKETSMAISISLDKYCHPVALPKHKLVCD
PELERPRTEMPNQLRKQLEEIIATDPLHPLTPEDKELLWHFRSEIVKHPEAYPKLLSSVK
WGQQEMVAKTYQLLSKREAWDDCSLDVGLTIQLLDCNFSDENVRAMAVQKLESLQDDDVL
HYLLQLVQAVKFEPYHDSALSRFLLKRALQSKRIGHFLFWFLRSEIAQSMHYQQRFAVIL
EAYLRGCGKAMLDDFTRQVQVTEILHKVTMEIKSVSAEKYDVTSQVITQLRQKLEKLQNS
KLPDKLPDSFRVPYDPGLRAGSLVVEKCKVMASKKKPLWLEFKCSDTTALSNETIGIIFK
HGDDLRQDMLILQILRIMGSIWEAESLDLCLLPYGCISTGNKIGMIEIVKDATTIAQIQQ
STVGNTGAFKDEVLSQWLKEKCPIEEKFSAAVERFVYSCAGYCVATFVLGIGDRHNDNIM
VTESGNLFHIDFGHILGNYKSFLGINKERVPFVLTPDFLYVMGTSGKKTSQYFNKFQDVC
VKAYLALRHHTNLMIILFSMMLMTGMPQLTSKEDIEYIRDSLTVGKNEESAKKHFLDQIE
VCRDKGWTVQFNWFLHLVLGIKQGVEKHSA
NT seq 3333 nt NT seq  +upstreamnt  +downstreamnt
atggagctggacagttatgaacagcctgttgttttaagagatgaaaaccagcgcagaaga
agaagaatgaggccacattctgcaacttccaacatgtttcccatggagcaaattccaata
gagtttattctgcccacaagtaacaggtgtagtaaagtacaggaaacaatgctgcttgaa
gttgctggcaattgcagtgttgagcagatgaaagcacagatttggatgcatgctattgaa
aaaagccacaacagcgatttttaccagagacttactccagaccagtttctgctgcagtat
caaaagaaaggacagtggtatgaaatatatgacaaacatcaagtaatacaaacactagac
tgtataatgtactggaaggttttacaaaaaactgtaggaaagattcatattgtgcagaaa
gaaaaaatccctgaagaaatgatagagtatcagaaaacattaaattatttgattggatat
gatgttacagatgtaagcaatgtccatgatgatgagctagaatttacacgtcgtagatta
gtcacaccacgaatgattgaactgtccaggagagatgctaggttatattctatggaccca
tgggtgacttgtaaatcacttccagaatatttatgtcaaagaattatatccaatagcatt
ttcatcatcatacataaaggaatgacaagccacacaatcagagtttctattgatgataca
ccagatgtaatattgcacagtttctttacaaaaatggcaaagaagaagtcattgttagat
atttctgaggagaacagtgaacttgattttgtcctgagagtttgtggcagagatgaatat
attattggaaatgcaccaattaaagattttcattggataaggcagtgcattaaaaatggc
caggaaatacaccttgttttagaaaagcctcctgatccattaatggatgaggtccagaaa
gaacagtggcctttggttgatgactgcacaggtgtcacagggtaccatgagcaactaacg
attgaaggaaaggaccacgaaaaaattttcactatatcactttgggactgcaaccggaag
tttagagtaaaaatcattggaattgatatacctgttctgccaaaaaacactgagcttatt
gcatttgtcgaagccaacattcagcatggccaacaagtcctttcacagaggagaactaca
tgcaagccttttactgaagaagttctatggaattcatggcttgaatttgatataaaaatc
aaagatttaccaaaaggagctcttttaaatctacaaatattttgtggtaaagcaccaact
gcttcaaacaaatctattgtacaatcaccagagtctacagcttcagactccaaatgcaaa
aaccagttactttactatgtgaatctgctgttaatcgatcacaggtttttattaagacag
ggggagtatgtccttcacatgtggaaaattccaggtaaaggagaggaacaaggaagcata
aatgctgataaacttacatctgcaactaatcctgacaaagaaacatctatggcaatttcg
attagtctagacaagtactgccatcctgttgcactccctaaacacaaactggtgtgtgat
ccagagcttgaaaggccaaggactgaaatgcccaaccaactcagaaagcagcttgaagaa
atcatagctacagacccactacacccccttacacctgaagataaagagctgctatggcat
ttcagatctgaaatagttaaacatccagaggcctatccaaagctgctaagttcagtaaag
tgggggcaacaggaaatggttgccaagacatatcaattattgagtaaaagagaagcatgg
gacgattgctctcttgatgttggacttacaattcagcttcttgactgtaatttttcagat
gaaaatgtaagagccatggcagttcagaaactggaaagtttgcaagatgatgatgtactg
cattatcttttacagctagtacaggctgtaaagtttgaaccatatcatgacagtgcttta
tccagattccttttaaaacgtgcattacaaagcaaacggattggccacttcttgttctgg
tttctgagaagtgagattgctcagtcaatgcattatcaacaaaggtttgctgtcatactg
gaggcctatttaagaggctgtggaaaagcaatgctggatgactttaccaggcaggtgcaa
gttactgagatcctgcataaagttacaatggagatcaagtcagtttctgctgagaaatat
gatgtaacttcacaagtcattacacagctgcgccaaaagcttgagaaactgcagaattca
aagcttccagataagcttcctgatagcttccgagtgccttatgatcctggattaagagct
ggttccttggtggttgaaaaatgcaaagttatggcttcaaagaaaaagccactttggctt
gaatttaaatgttcagacacaacagcgttatcgaatgaaacaataggaataatatttaag
catggagatgacctacggcaagatatgcttattttacagatccttcgcatcatgggctct
atatgggaagctgaatcactggacctgtgtttactgccatatggctgcatttccactgga
aacaaaataggaatgatagaaatagtaaaggatgccacaaccattgcacaaatacagcag
agtacagttggtaacacaggagcctttaaagatgaagttctgagtcagtggttgaaagag
aaatgtccaattgaggaaaagttcagtgcagcagtggaaagatttgtttattcctgtgct
ggatactgtgttgcaacatttgtgcttggaattggggacagacataatgacaatataatg
gtaactgagtcaggtaacctgttccatatagattttggtcatattcttggtaactacaaa
agttttctgggaatcaacaaggaaagggtgccctttgtgttaacacctgatttcctttat
gttatgggaacatcaggaaagaagacaagtcagtactttaataaatttcaggatgtctgt
gtaaaagcatatttggctcttcgacatcatacaaatctaatgatcatcctgttttcaatg
atgctgatgacaggtatgcctcaactgacaagtaaggaggacattgaatacatccgggac
tcactgactgttggaaaaaatgaagagagtgccaagaagcattttcttgaccagattgaa
gtttgtagggataaaggctggactgtgcagtttaattggtttctacaccttgtgctgggc
attaaacaaggggtagaaaagcattcagcttga

DBGET integrated database retrieval system