KEGG   Xenopus tropicalis (western clawed frog): 100158575Help
Entry
100158575         CDS       T01011                                 

Gene name
josd1
Definition
Josephin domain containing 1
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100158575 (josd1)
Peptidases [BR:xtr01002]
 Cysteine Peptidases
  Family C86
   100158575 (josd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 201 aa AA seqDB search
MSCVPWKGDKAKSGLEAQEPLPPQIYHEKQRRELCALHALNNVFQDAGAFTRETLQEIFQ
RLSPNTLVTPHKKNVLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVNLICLSNVTGFIMN
LPSSLSWGPLKLPLKRQHWICVREVGGNYYNLDSKLKRPEWIGSEDDLRKFFRYHLRGKN
CELLLVVPEEVEVHQRWRTDL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgagttgcgttccatggaaaggggacaaggcaaaatctggattggaggcccaagaacct
cttcctccacaaatctaccatgagaagcagcgtcgggaactctgtgccctgcatgccttg
aacaatgtcttccaggatgctggagcattcacccgagaaaccctgcaggagatatttcaa
aggttgtcccccaacactttagtgactcctcacaagaagaatgtgttgggtaacgggaac
tatgatgtcaatgttattatggcagcacttcagaccaagggatatgaagctgtatggtgg
gacaaaaggagggatgtcaatttgatatgtctttctaatgttactgggtttattatgaac
cttccatcaagtctgtcttggggaccccttaagcttccactcaaaaggcagcactggata
tgtgtacgtgaggtaggaggcaactactacaacctcgactccaaactgaaaaggccggag
tggattgggagtgaagatgatctaaggaaatttttcagatatcacttaagaggcaaaaac
tgtgagctgcttttagtggtaccggaggaggttgaagttcatcagcgctggaggactgat
ctataa

DBGET integrated database retrieval system