KEGG   Xenopus tropicalis (western clawed frog): 100158604Help
Entry
100158604         CDS       T01011                                 

Gene name
usp15
Definition
ubiquitin specific peptidase 15 (EC:3.4.19.12)
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Ensembl: 
UniProt: 
Position
Un
AA seq 955 aa AA seqDB search
MAEGGVVDLETQRSEVSALLKTPLRRGDTWYLIDSRWFKQWKKYVGFDSWDKYQMGDQNV
YPGPIDNSGLLKDTDTQSLKEHLIDELDYILLPTEGWNKLVSWYSVVESQQPIARKVVEQ
GMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDMIEKEMRTIFSIPDEKETRLW
NKYMSNTFEPLNKPESTIQDAGLYQGQMLVIEQKNQEGQWPRGSMPNMKNSNYCLPSYAA
YKNYEYSEPGRHNEQPGLCGLSNLGNTCFMNSAIQCLSNTPPLTEYFLNDKYQDELNMDN
PLGMRGEIAKSYAELIKQMWSGKYSYVTPRAFKTQVGRFAPQFSGYQQQDCQELLAFLLD
GLHEDLNRIRKKPYIQLKDADGRPDKVVAEEAWENHIKRNDSIIVDIFHGLFKSTLVCPE
CSKISVTFDPFCYLTLPLPMKKERALEVYLVRMDPLAKPMQYKVIVPKIGNIMDLCTALS
SLSGIAPEKMVVTDIYNHRFHRIFAMDENLSSIMERDDIYVFETSINRTEDTEQVIIPVY
LREKFRHTSYSHHHGSTLFGQPFLITVPRNITEDKLYNLLLLRMCRYVKATNDTEEIDGS
LHCNKEHTVNGNGPNGIHEEGSPSEMETDEPDDESSQDQELPSENENSQSEDSVGGDNDS
ENGLCTEDTCKGQSVTGQKKRLFTFQFSNLGSSDITYIKDDTKYIRFDERQLRLDERSYL
ALDWDPKLKKKFFDENAAEDFEKHESVDFTPQKKAFMKLKDCIELFTTKEKLGAEDPWYC
PNCKEHQQATKKLDLWSLPPVLVVHLKRFSYSRYMRDKLDTLVDFPISDLDMSTFLINPN
AGPCCYNLIAVSNHYGGMGGGHYTAFAKNKDDGKWYYFDDSSVSTASEEQIVSKAAYVLF
YQRQDTITGTGFFPLDKEVKQGASAATGAPHESDEESNEDENDIENENYLEKLDH
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
atggcggagggcggagtggtggatctggagactcagagatccgaagtgtcagccctgctg
aaaacccctctcagaagaggagacacctggtacctgattgatagtcgctggtttaagcag
tggaaaaagtatgtggggtttgacagctgggacaaataccagatgggagatcagaatgtg
tatccaggccccattgataactctggactcctcaaagatactgacactcagtctcttaag
gagcatcttatcgatgagcttgactacattttgttgcccactgaagggtggaacaagctt
gttagctggtattctgtggtagaaagccaacagcctatagcacgcaaggtggttgaacag
ggtatgtttgtaaagcactgcaaagtagaagtttatttaacagagttaaaactttgtgaa
aatggaaacatgaacaatgtcgtcacacgacgattcagcaaagcagatacaatcgacatg
attgaaaaagaaatgagaacaatctttagtattccagatgaaaaagagaccagactgtgg
aacaaatacatgagcaatacatttgagcctttgaataaacctgaaagcactatacaggat
gctggactataccaaggacagatgctagtaattgaacagaaaaatcaagaagggcagtgg
ccaagaggttctatgcctaatatgaaaaattcaaactattgcctgccttcatatgctgcc
tacaagaactatgaatactctgagccaggaagacacaatgaacaacctggactctgtggt
ctcagcaacttggggaacacttgttttatgaattctgcaattcagtgtctgagcaatacc
cctccacttactgaatacttccttaatgacaagtatcaagatgaattaaacatggataac
cctttaggaatgcgaggtgaaatagccaaatcctatgcagagctcattaaacaaatgtgg
tcaggaaaatacagctatgtaacaccaagagcatttaagactcaggtggggcgttttgca
ccacagttttctggttatcaacaacaagattgccaggaattgcttgcatttttattagat
ggcttacatgaagatttgaaccgaattcgaaagaagccttacatacaattaaaagatgca
gacggaaggccagacaaggtagttgctgaagaagcctgggagaaccatataaaaaggaat
gactcaattattgttgatatatttcatgggttatttaagtccactttagtatgtcctgaa
tgttctaaaatatctgtaacgtttgatcctttctgttaccttactcttccactgcctatg
aaaaaagaacgtgcattagaagtttatctagtaagaatggacccacttgccaaacctatg
cagtataaagtaattgttccaaaaattggaaacattatggacctttgcacagccctttcc
tcattatcaggcattgccccagaaaagatggtagttactgacatctacaatcacagattt
cacaggatatttgcaatggatgaaaacttaagtagtattatggaacgtgatgacatttac
gtattcgaaacatccatcaatagaacagaagatacagaacaggttataattcctgtttat
ttacgagaaaaatttcgtcatacaagttacagtcatcatcatggttctactttgtttgga
caaccatttcttattactgtgcctagaaatattactgaggataaactttataatctgctc
ttgttaagaatgtgccgatatgtaaaagccacaaatgacactgaagaaattgatgggtct
ttgcactgcaataaagaacatactgtcaatggaaatggcccaaatggtatccatgaagaa
ggttcaccaagtgaaatggaaacagatgaaccagatgatgagtctagtcaggatcaagag
cttccttcagaaaatgaaaatagccaatctgaagactcagttggaggagataatgactcg
gaaaatggattgtgcactgaagatacttgcaaaggacaatcagtaacgggacaaaaaaaa
cgcttgtttacattccagttttctaatttgggcagttctgatattacctatataaaagat
gatacaaaatatattcgatttgatgaaaggcaactcaggttggatgaaagatcttacctt
gccttagactgggatcccaagctaaagaaaaaattctttgatgagaatgcagcagaggac
tttgaaaaacacgaaagcgtggattttactccacagaaaaaagcatttatgaaattaaaa
gattgcattgaactgttcacaactaaggaaaaactgggggctgaggatccatggtactgt
ccgaactgcaaagaacatcagcaagcaaccaaaaaattagatctctggtccttgccccct
gttcttgtggtacatttgaaacgtttctcttacagtagatacatgagagataaactggat
acactggttgattttcctataagtgaccttgacatgtcaacatttcttattaatccaaac
gcgggtccttgctgttataatttaattgctgtgtcaaaccactatggaggaatgggtggc
ggccactatacagcttttgctaaaaataaagatgatggaaaatggtattattttgatgac
agtagtgtgtcaactgcatctgaagaacagattgtgtcaaaggcagcatatgtgctcttc
tatcaaaggcaagataccattactggaacaggtttttttccccttgacaaagaagttaag
caaggtgcttcagctgccacgggagccccacatgagagcgatgaagaatcgaatgaagat
gaaaacgacatagagaatgaaaattacctagaaaagctggatcattga

DBGET integrated database retrieval system