KEGG   Xenopus tropicalis (western clawed frog): 100158622Help
Entry
100158622         CDS       T01011                                 

Gene name
rad54b, fsbp, rdh54
Definition
RAD54 homolog B
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    100158622 (rad54b)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     100158622 (rad54b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 897 aa AA seqDB search
MRRSAAPSQLSGNPAKKPRFIPPGKVNAACPDTETKHSITDSTDKKQLSSRAFEERCGLN
TVLPRAEGSAQPLSSNKTAIMTSVPVCRSVAGAIKEHKNEVEESSSFAKYFSVVWCKASK
KKHKKWEGDAVLIAKGRAVTLKDMEGKDIGKGTGYKIKDLESLEEGHTLMIGGKEIEVMS
IMSPEDYNSGRCFHSVVTSPASTPSESIQMKPFTNPLRNDRKGASKENMFKELQNIKPRH
DPCAPNAFVMPKPTQHHQWAYNKTGLPIVDVVVDPYLAVHLRPHQKEGILFLYECVMGMR
VNERFGAILADEMGLGKTLQCISLIWTLIRQGPYGGKPVIKKALIVTPGSLVKNWRKEFQ
KWLGTERIRVFAVDQDHKVEEFMKSPLYSVLIISYEMLLRCLEQIQSLDFDVVICDEGHR
LKNTSIKTTSALASLTCSKRIILSGTPVQNDLQEFFALIEFVNPAALGSLSTYRKIFEEP
IIRSREPTATTEEKNLGEERAAELARLTGLFILRRTQEVINKFLPPKIESIVFCRPSQFQ
LDLYRKLLNSRTVKSCLLGSGESSPHLVCIGALKKLCNHPFLLFRTIQGKSTNPDQDEHN
LYESVAEVFPQDYDGAKISESESGKLLVLSNLLSRIRELSPSERVVLVSNYTQTLNILQD
LCNQHGYSCTRLDGQTPVTQRQHIVDGFNSKYSTDFIFLLSSKAGGVGLNLIGASHLILY
DLDWNPANDIQAMARVWRDGQRHTVHIYRLLTTGSLEEKIYQRQISKQGLSGAVVDLTKK
SEHIRFSLDELRNLFTLHEDTDCVTHDLLQCDCTITNCHSDGSPQKPLIHRSCQLGLHQD
QLNKNFSMSELMQWKHFSGQQNTEDPFLQMGKEHISFVFQNTTNSQVNPTSELSPAS
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagatcggccgccccaagtcaactctctgggaatccagcaaagaaacctcgtttt
atacctcctggaaaagttaatgcagcatgcccagatacagaaaccaaacattctataact
gattcgacggataaaaaacaattgtcttcaagagcctttgaagaaagatgtgggctgaac
acagtgcttcccagggcagaagggagtgcgcagcctttgagcagcaataaaacagccatt
atgacaagtgttccagtgtgtagatctgtggctggtgcaataaaagaacacaagaatgag
gtggaagaaagcagctcttttgcaaagtatttcagtgttgtttggtgcaaggcctccaag
aagaagcacaagaagtgggaaggagatgccgtcctaatcgctaaagggagagcagtgaca
ttaaaggacatggagggaaaagatattggaaaaggtacggggtacaagataaaagacctt
gaaagcctggaagaaggtcacactctgatgattggtgggaaagaaatagaagtaatgtct
ataatgtctcctgaagattacaacagtggccgatgtttccattccgtagtaacatcacca
gcatctaccccttcagaatctattcaaatgaagcccttcactaacccactgagaaatgac
cgtaagggtgctagcaaggaaaatatgtttaaagagcttcagaatatcaaacctcgtcat
gatccttgtgctccgaatgcttttgttatgccaaaaccaacgcagcatcaccagtgggct
tataataagactggcctgccaatcgtagatgtggtggtggatccctatttagctgttcat
cttagacctcatcagaaagaaggcattctctttctttatgaatgtgtgatgggaatgagg
gttaatgagcggtttggcgctatccttgctgatgaaatgggtctggggaagaccctgcag
tgcatctccctgatctggacactgatccgtcagggcccatatggaggcaaacctgttata
aagaaagcactcattgtcacgccaggtagtctggtgaaaaactggaggaaggaattccag
aagtggctgggaacagagcgtatccgagtattcgcagtagaccaggatcacaaagtggaa
gagttcatgaaatcccctctttattcggtgctcataataagctatgagatgctgttacgc
tgtctggaacaaatacaaagcctagattttgacgtagtaatttgtgacgagggtcaccgc
ttaaagaacacgtctataaaaactacaagcgctctggccagtctaacttgcagcaagcga
ataatattgtccggcactccagttcagaatgatctccaggagttttttgcactgattgag
tttgttaaccctgccgcacttggctctttgtccacgtacagaaaaatatttgaagagcca
attattaggtctcgggagccaacagcaacaactgaagagaagaatctgggagaagaacga
gcagccgaactagcacgactgacaggtctttttatacttagaaggacccaagaggtcata
aataaattcctgcctccgaaaatcgaaagcatcgtcttctgccgcccatctcaattccag
cttgatctgtacagaaagcttctgaactcacgcactgttaaatcttgtctgctgggaagt
ggagaaagcagcccccacctggtgtgcattggcgcgcttaaaaaactgtgcaaccatcca
ttcctgctgttccgaactatccagggtaaaagcacaaatcctgatcaggatgaacacaat
ctgtatgaaagtgtagctgaagttttcccccaggattatgacggtgctaaaatttcagag
tcagagtctggaaagctgctggtcctgagtaacctgctgtctagaatacgggagcttagc
ccatctgagagggtggtattggtctcaaattatacacagaccctgaacatattgcaagac
ctgtgtaatcagcatggatacagttgcacaaggctggatgggcagacaccggttacacag
agacagcacattgttgatggatttaacagcaaatactcaacagacttcatcttcttgctg
agttccaaggctggaggtgttggcctcaatctgatcggtgcttctcatttgattctgtat
gacctcgactggaatcctgcaaatgatatacaggcaatggctcgagtgtggagggatgga
cagcggcacactgtgcatatttaccggcttctcacaacaggttcattagaggaaaagatc
taccagaggcagataagtaagcaaggcctgtctggtgctgtcgtggacttgacaaagaaa
tccgagcacatccgcttttccttagatgagctgagaaatctatttactctgcatgaagat
acagattgtgtgactcacgatctactgcaatgtgactgcacaatcacaaactgccattca
gatggttcgcctcaaaagccgttaatccataggagttgtcagcttggattacaccaggat
cagcttaataagaatttttccatgtctgagctcatgcagtggaaacatttctctgggcag
cagaatacggaagatccctttctgcaaatgggaaaagaacatatttctttcgtttttcag
aatacaacaaacagccaagtaaacccaacgtctgaactttctcctgcctcgtga

DBGET integrated database retrieval system