KEGG   Xenopus tropicalis (western clawed frog): 100158627Help
Entry
100158627         CDS       T01011                                 

Gene name
hdac7, hdac7a
Definition
histone deacetylase 7
Orthology
K11408  
histone deacetylase 7 [EC:3.5.1.98]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 977 aa AA seqDB search
MPGLHQMLNTIYEADSASSTDGIRRGESGLRFGHKSGATGAVDLSAPVSTILTQANPMAF
QIVHRIGHHTEPTLLPIKQTQPQLYSSLSQHQPVEHPLRREAPCRNAELVRQEPSLRQLV
NKDKGKASAMASPAVKQKIVEMIQKKKFDQNNIANHSTAAAPYRSPEIVEKEPPPPPIMT
NFASQVSSNSCNPSEHFPLRRTASEPNLKWPCRPKKSGERRKNPLTRKESAPPAVRRRPP
ETQDSSPSSSSTPVSGCSSPNDSIPAENGSLSSIPGAASEGEVSRRAVPGVVHRGPYLTT
HPIFMAPGIEGHDGTNPLATRLQPVIILEQSGAHTPLVAVQGLGSVQFAHAFISPDHHKP
LSRTRSEPLPQNPKTLQQQLLYQQQYSIFPEHMKQQRQLSKRSQKTSERPRLSQIPSEEM
DESSSPTADRPNDVGGNPARARSESLRVGQHETLSSSQQAIQQQQQQHSFHQQAYLYESS
LHRPVKRPLDVLTIPLMPGGHRPLSRAKSSPASASLPAQEPSAKAMSIPMPEQATKPRFT
TGIVYDSVMLKHQCTCGDNSNHPEHAGRIQSIWSRLQERGLRNNCECIRGRKATLEELQS
VHTETHVLLYGTNPLNRLKLDNRKLAGILSQRMFVMLPCGGLGVDSDTIWNELHSSNAAR
WAAGSVIDLAFKVASRELKNGFALVRPPGHHADPSTAMGFCFFNSVAIAAKQLQLRRDVR
KILIVDWDVHHGNGTQRVFYTDPNVLYISLHRHDDGNFFPGSGAADEVGAGNGEGFNVNV
AWTGGLDPPMGDVEYLTAFRTVVMPIAHEFSPDVVLVSAGFDAAEGHPAPLGGYKVTAKC
FGHMTRQLMSLAGGRVVLALEGGHDLTSICDASEACVSALLGNELDPLPEETLRQRPNQN
AVCSLETVIHVQSKYWTSVKQFASKVQYTLLEAQKHDRDEVDTVTALASLSVGRGSIAVA
GNRPQEEPMEEDEPMSL
NT seq 2934 nt NT seq  +upstreamnt  +downstreamnt
atgcctggattacatcaaatgctaaacaccatttacgaggctgattccgcttcttccaca
gatggcatcagacggggcgagtcggggctgaggtttggccacaagagcggtgctactgga
gcagtggatttgagcgccccagtcagcacaattttgactcaggccaatcccatggcattc
cagattgtccatcgcattggtcatcacactgagccaacactcttgcccatcaagcagacc
cagccacagctctactcaagcctctcccagcaccagcctgtggaacatccattgcggcgg
gaggcaccctgccggaatgcagagcttgtgcgacaggaaccaagtttacggcagcttgtg
aacaaggataaaggaaaagcaagtgccatggccagccctgcagtaaagcagaaaattgta
gagatgatccagaaaaagaaatttgatcaaaacaatattgcgaatcacagcaccgctgct
gcgccttacaggtctcctgaaattgttgagaaagaacccccaccacctcctatcatgact
aactttgcttctcaggtctctagcaactcctgtaacccctctgagcacttccccctacgc
aggacagcctccgagccaaacctcaaatggccctgcagacccaagaagtctggagagcgg
aggaaaaacccccttacccgaaaggaaagtgctccacctgctgtcagaaggagaccccca
gagacacaggactcgtcaccaagcagtagcagtaccccagtgtcaggatgcagttctcca
aatgatagtatccctgcagaaaacggaagcctttcctccatccctggagctgcctctgag
ggagaagtcagtcgaagagcagtaccaggtgtggttcatcgtggcccctatctaacaaca
caccctatcttcatggcacctggcatagagggtcatgatggcaccaacccccttgccaca
cgcttgcagccagtcatcattctggaacagtcaggggcacacactcctctggtagcagtt
caaggcctgggctccgttcagtttgcacatgcttttataagccctgatcaccataagcct
ttgagccggacccgctcagaacctcttcctcaaaacccgaaaacactccaacagcagctg
ctgtatcagcagcagtactccatattccctgaacatatgaagcagcagcgccagttaagt
aagcgctcacagaaaaccagtgagaggccacgcttgtcccagatcccatcagaggaaatg
gatgagagttctagtcccacagctgaccgccccaatgatgtgggaggaaatcctgcccga
gcgaggtcagaatcactgcgagttgggcaacatgagactctcagcagcagccaacaagca
attcagcagcaacagcaacagcactccttccatcagcaggcctatttatatgaatccagc
ctccacagacctgtgaaacggccactcgatgtgctaacgatccccttgatgccaggtggg
catcggcctctttcccgagcaaagtcctctccagcctccgcatctctgccagctcaagag
ccttctgccaaagcaatgtcaattcctatgccggaacaagctaccaagcctcgcttcact
acaggaattgtgtatgactcagtaatgctgaaacaccagtgtacttgtggggacaacagc
aatcatccagagcatgctgggagaatccagagcatctggtcccgcttacaagagagagga
ttacgcaataattgtgaatgcatccggggaaggaaggctacattagaggagctgcagtct
gtgcacacagagacccatgtcctgctctatggaactaatcccctcaacagactcaaactg
gataaccgcaagcttgcaggaattctgtcccagaggatgtttgtaatgctgccatgtgga
gggcttggggtggacagtgacaccatctggaatgaactccactcctctaatgcagcccgc
tgggcagcaggcagtgtcattgacctggcatttaaagttgccagccgagagctgaagaac
ggctttgcattagtcagacccccaggacatcatgcagacccctcaacagccatgggcttc
tgcttctttaactcagtggccattgcagcaaaacaactgcaactaagacgtgatgtaaga
aagatcctcattgtagactgggatgtacaccatggaaacgggacacaacgagtattttac
acagaccccaacgtgctgtatatctcattgcatcgacatgatgatggcaactttttcccg
ggcagtggagcagctgatgaggttggtgcaggcaatggcgaaggctttaatgtcaatgtt
gcatggacgggtggtttggatcccccaatgggggacgtggaatacctgacagcctttcgg
acggtggtaatgccaatagcccatgagttctctccagatgttgtcttggtttctgctggg
tttgatgcagctgaagggcatcctgctcctcttggaggatataaagtcacagcaaaatgc
ttcgggcacatgacacggcagcttatgagcttagcaggaggccgagtggtgcttgctctg
gagggtggccatgatctcacatctatatgtgatgcttcagaggcctgtgtctctgccctg
ctgggaaatgagctggatcccctccctgaagagacgttaaggcagaggcccaaccaaaat
gctgtgtgttctttggaaaccgtcatacatgtccaaagtaaatactggacatcggtcaaa
cagtttgcttccaaggttcaatacacccttctggaagcccagaaacatgatcgggacgaa
gtggacacagtgacagctttagcctccttgtcagttggaaggggatctattgcagtagct
gggaacaggcctcaggaagagccaatggaggaagatgaacccatgagtttatga

DBGET integrated database retrieval system