KEGG   Xenopus tropicalis (western clawed frog): 100170153Help
Entry
100170153         CDS       T01011                                 

Gene name
thbs1, thbs, thbs-1, tsp, tsp-1, tsp1
Definition
thrombospondin 1
Orthology
K16857  
thrombospondin 1
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
p53 signaling pathway
Phagosome
TGF-beta signaling pathway
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    100170153 (thbs1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100170153 (thbs1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100170153 (thbs1)
  Cell growth and death
   04115 p53 signaling pathway
    100170153 (thbs1)
  Cellular commiunity
   04510 Focal adhesion
    100170153 (thbs1)
Heparan sulfate/heparin binding proteins [BR:xtr00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  100170153 (thbs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 1176 aa AA seqDB search
MGMMKGIFLLLMLAVPQTYQAAESGNDDNSVFDLFELTGYNRKTGSRKPEGLHLVKGPDP
SSPAYRIEDADLIPPLPEVKFQDLLDAIRADRGFILLATLRQAKKSRGALLSVERKDGAG
HIFSLISNGRAGTLDLSLSGERKQQVVSVEDALLATGHWKNITLFVQDDRAQLYVGCDKM
ENAELDVPIQKIFTEDLASKAHLRVAKGGVKDNFQGVLQNVRFVFGTTLEAILRNKGCSS
MTNSVITLDNPVNGSSPAIRTNYIGHKTKDLHAVCGISCDDLSKLFAEMKGLRTLVTSLQ
DQVTKETERNELIAQRVTMTPGACLHNGVLHKNRDEWTVDSCTECTCQNSATICRKVSCP
LMPCTNATIPDGECCPRCWPSDSADDDWSPWSDWTPCSVTCGHGIQQRGRSCDSLNNRCE
GSSVQTRSCHIQECDKRFKQDGGWSHWSPWSSCSVTCGSGQITRIRLCNSPVPQLNGKPC
EGEGRENKPCQKDPCPINGQWGPWSLWDTCTVTCGGGMMKRERLCNNPKPQYGGKECIGD
PTDSQICNKQDCPIDGCLSNPCFAGVKCTSFIDGSWKCGSCPPGYRGNGITCKDIDECKE
VPDACFSLNGVHRCENTEPGYNCLPCPPRFTGTQPFGKGIDEAKANKQVCKPRNPCADGT
HDCHRNARCIYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLTCVANATYHCM
KDNCPNLPNSGQEDYDKDGMGDACDKDDDNDGILDDRDNCQFVYNPAQYDYDRDDVGDRC
DNCPYNHNPDQADTDRNGEGDACAVDIDGDGILNERDNCPYVYNVDQRDTDKDGVGDQCD
NCPLEHNPEQTDSDSDLIGDKCDNNQDIDEDGHQNNLDNCPYIPNANQADHDKDGKGDAC
DHDDDNDGVPDDKDNCRLVPNPDQTDSNGDGRGDACQYDFDDDNIPDAEDVCPENVEIST
TDFRKFQMVPLDPKGTSQIDPNWVVRHQGKELVQTVNCDPGIAVGFDEFSAVDFSGTFFI
NTERDDDYAGFVFGYQSSSRFYVVMWKQITQTYWDTTPTVAQGYSGLSIKVVNSTSGPGE
HLRNALWHTGNTPGQVRTLWHDPHQIGWKDFTAYRWHLTHRPKTGFIRVVMYEGKKVMAD
SGPIYDKTYAGGRLGLFVFSQEMVFFSDLKYECRDS
NT seq 3531 nt NT seq  +upstreamnt  +downstreamnt
atggggatgatgaagggcattttcctactgttgatgttggccgtgcctcaaacatatcaa
gcagcagaatctgggaatgatgataacagtgtatttgatctgtttgagttaacgggatac
aaccgcaaaactggttctcgtaagcctgaaggactccatttagtaaagggacctgaccct
tcaagcccagcttatagaattgaagatgctgacttgatcccaccactgccagaagtcaaa
tttcaagatttgctggatgcaatacgtgctgatagggggttcattttgttggcgactctg
cgtcaagcaaagaaaagtcgaggggcacttctgtctgtggagagaaaagatggcgcaggg
cacatcttcagtctgatctccaatggccgggctggaaccctagatttaagtttaagtgga
gaaaggaagcagcaggtggtgtctgtagaagatgctctcctagctactggccactggaag
aacatcaccctctttgtacaagatgaccgtgcacagctctatgtaggatgtgacaagatg
gaaaatgctgagctagatgtgccaatacagaaaatatttactgaggacctggcaagcaag
gctcatcttcgagtagcaaagggaggagtaaaggacaactttcagggagtccttcagaat
gtacgctttgtgtttggaaccacattggaagctattctgagaaacaaaggctgctcaagc
atgacaaactcagtcatcactttggacaacccagtgaacggctcaagcccagccatccga
acgaattacattggccacaaaacaaaggacctgcatgctgtgtgtggcatttcctgcgat
gatctgtccaaactgtttgcagaaatgaaaggcttacggacgctggtcacatctctccag
gaccaagtcaccaaagagacggagaggaatgaacttattgctcagcgagtaacaatgacg
ccaggtgcttgtctccacaatggagtcttgcataagaacagagatgagtggaccgttgac
agctgcactgaatgcacatgtcagaactcagctaccatatgccgtaaggtatcttgccct
ctgatgccctgtaccaatgccaccattccagatggggaatgctgtcccagatgttggcca
agcgactcagctgatgatgattggtctccatggtcagattggacaccttgctctgtgaca
tgtggacatggcatccagcagagaggacgttcctgcgacagccttaataaccgctgcgaa
ggttcttctgtacagacacgatcttgccatatccaggaatgtgacaagagatttaagcaa
gatggtggatggagccactggtcaccttggtcatcatgctcagttacctgcggaagtggt
caaatcaccagaatccgtctctgcaactcccctgttcctcagctgaatggaaagccatgc
gaaggggaaggaagggagaacaagccatgtcagaaagacccatgcccaattaatggtcag
tggggtccttggtcactgtgggacacatgcactgttacttgcggtggtggaatgatgaag
agggagcgtctctgcaataaccccaaacctcagtatgggggtaaagagtgtattggagat
cctactgattctcagatctgcaacaaacaggactgtcccatagatggatgtctctctaac
ccttgctttgctggagtcaaatgcaccagcttcattgatggatcttggaaatgtggttcc
tgcccaccagggtacagaggaaatggaataacatgcaaagatattgatgagtgcaaagag
gtgcctgatgcctgcttcagcctgaatggagttcatagatgtgagaatacagaaccagga
tataattgtctcccatgccctcctcggttcacaggaactcagccatttggcaaaggcatt
gatgaagctaaagccaataagcaggtttgcaagcctcgcaacccatgcgccgatggtacc
cacgactgtcacaggaacgccagatgtatctaccttggacactacagcgaccccatgtac
cgatgtgagtgcaaacctggatacgcaggaaatggaatcatttgtggcgaagacacagat
ttggatggctggccaaacgagaacctcacatgtgttgctaatgctacctatcactgcatg
aaagataactgccccaacctccccaactcaggccaggaagactatgataaggatggaatg
ggagatgcctgcgataaagacgatgacaatgatggaatcctagatgacagggacaactgt
cagtttgtgtataacccagcacagtacgactatgatcgtgatgacgtgggagaccggtgt
gacaactgcccttacaaccacaacccagaccaggctgacacagaccgcaatggagaagga
gatgcctgtgctgtggacattgatggagatgggatcctaaacgagagggataactgcccc
tatgtgtacaatgtcgaccagagagacacagataaggatggtgttggagaccaatgtgat
aactgcccactggaacacaatccagaacagactgactctgattctgacctcattggcgat
aagtgtgacaacaaccaagatatagatgaggatgggcatcaaaataacctagataactgc
ccctacatccccaatgccaaccaagcagatcatgataaggatggcaagggtgatgcatgt
gaccatgatgatgacaatgatggtgttcctgatgacaaagataactgccgattggtccct
aacccagaccaaacagattctaatggtgatggccgtggagatgcttgccaatatgacttt
gatgatgataacatacccgatgcagaagatgtttgcccagagaatgtggaaatcagcact
actgacttccgtaaattccagatggtgcctttggatcccaaagggacatcacagattgat
cctaactgggtggtgagacaccaaggcaaagaactggttcagactgttaactgtgatcct
ggaattgcagttggttttgacgagttcagtgctgttgacttcagtggcacatttttcatc
aacaccgagagagatgacgattatgccggctttgtgtttggataccaatccagcagcagg
ttttacgtagtcatgtggaagcaaatcactcagacatactgggacacaactcccactgta
gctcagggctactctggcctctcaatcaaggttgtgaactctaccagcggaccaggggag
cacctacgaaatgcactgtggcacacaggaaacacccctgggcaggttcgcaccttgtgg
catgatcctcaccagatcggctggaaagattttacagcttacagatggcacctgacccac
agaccaaagaccggtttcattagagtcgtcatgtatgaaggcaagaaagttatggctgac
tcaggaccaatctatgataaaacatatgctggaggaagattaggattattcgtcttctca
caagagatggtcttcttttctgatctcaaatacgagtgcagagactcttaa

DBGET integrated database retrieval system