KEGG   Xenopus tropicalis (western clawed frog): 100170153Help
Entry
100170153         CDS       T01011                                 

Gene name
thbs1, thbs, thbs-1, tsp, tsp-1, tsp1
Definition
thrombospondin 1
Orthology
K16857  
thrombospondin 1
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
p53 signaling pathway
Phagosome
TGF-beta signaling pathway
Focal adhesion
ECM-receptor interaction
Class
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:xtr04350]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:xtr04512]
Cellular Processes; Transport and catabolism; Phagosome [PATH:xtr04145]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:xtr04115]
Cellular Processes; Cell communication; Focal adhesion [PATH:xtr04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 1176 aa AA seqDB search
MGMMKGIFLLLMLAVPQTYQAAESGNDDNSVFDLFELTGYNRKTGSRKPEGLHLVKGPDP
SSPAYRIEDADLIPPLPEVKFQDLLDAIRADRGFILLATLRQAKKSRGALLSVERKDGAG
HIFSLISNGRAGTLDLSLSGERKQQVVSVEDALLATGHWKNITLFVQDDRAQLYVGCDKM
ENAELDVPIQKIFTEDLASKAHLRVAKGGVKDNFQGVLQNVRFVFGTTLEAILRNKGCSS
MTNSVITLDNPVNGSSPAIRTNYIGHKTKDLHAVCGISCDDLSKLFAEMKGLRTLVTSLQ
DQVTKETERNELIAQRVTMTPGACLHNGVLHKNRDEWTVDSCTECTCQNSATICRKVSCP
LMPCTNATIPDGECCPRCWPSDSADDDWSPWSDWTPCSVTCGHGIQQRGRSCDSLNNRCE
GSSVQTRSCHIQECDKRFKQDGGWSHWSPWSSCSVTCGSGQITRIRLCNSPVPQLNGKPC
EGEGRENKPCQKDPCPINGQWGPWSLWDTCTVTCGGGMMKRERLCNNPKPQYGGKECIGD
PTDSQICNKQDCPIDGCLSNPCFAGVKCTSFIDGSWKCGSCPPGYRGNGITCKDIDECKE
VPDACFSLNGVHRCENTEPGYNCLPCPPRFTGTQPFGKGIDEAKANKQVCKPRNPCADGT
HDCHRNARCIYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLTCVANATYHCM
KDNCPNLPNSGQEDYDKDGMGDACDKDDDNDGILDDRDNCQFVYNPAQYDYDRDDVGDRC
DNCPYNHNPDQADTDRNGEGDACAVDIDGDGILNERDNCPYVYNVDQRDTDKDGVGDQCD
NCPLEHNPEQTDSDSDLIGDKCDNNQDIDEDGHQNNLDNCPYIPNANQADHDKDGKGDAC
DHDDDNDGVPDDKDNCRLVPNPDQTDSNGDGRGDACQYDFDDDNIPDAEDVCPENVEIST
TDFRKFQMVPLDPKGTSQIDPNWVVRHQGKELVQTVNCDPGIAVGFDEFSAVDFSGTFFI
NTERDDDYAGFVFGYQSSSRFYVVMWKQITQTYWDTTPTVAQGYSGLSIKVVNSTSGPGE
HLRNALWHTGNTPGQVRTLWHDPHQIGWKDFTAYRWHLTHRPKTGFIRVVMYEGKKVMAD
SGPIYDKTYAGGRLGLFVFSQEMVFFSDLKYECRDS
NT seq 3531 nt NT seq  +upstreamnt  +downstreamnt
atggggatgatgaagggcattttcctactgttgatgttggccgtgcctcaaacatatcaa
gcagcagaatctgggaatgatgataacagtgtatttgatctgtttgagttaacgggatac
aaccgcaaaactggttctcgtaagcctgaaggactccatttagtaaagggacctgaccct
tcaagcccagcttatagaattgaagatgctgacttgatcccaccactgccagaagtcaaa
tttcaagatttgctggatgcaatacgtgctgatagggggttcattttgttggcgactctg
cgtcaagcaaagaaaagtcgaggggcacttctgtctgtggagagaaaagatggcgcaggg
cacatcttcagtctgatctccaatggccgggctggaaccctagatttaagtttaagtgga
gaaaggaagcagcaggtggtgtctgtagaagatgctctcctagctactggccactggaag
aacatcaccctctttgtacaagatgaccgtgcacagctctatgtaggatgtgacaagatg
gaaaatgctgagctagatgtgccaatacagaaaatatttactgaggacctggcaagcaag
gctcatcttcgagtagcaaagggaggagtaaaggacaactttcagggagtccttcagaat
gtacgctttgtgtttggaaccacattggaagctattctgagaaacaaaggctgctcaagc
atgacaaactcagtcatcactttggacaacccagtgaacggctcaagcccagccatccga
acgaattacattggccacaaaacaaaggacctgcatgctgtgtgtggcatttcctgcgat
gatctgtccaaactgtttgcagaaatgaaaggcttacggacgctggtcacatctctccag
gaccaagtcaccaaagagacggagaggaatgaacttattgctcagcgagtaacaatgacg
ccaggtgcttgtctccacaatggagtcttgcataagaacagagatgagtggaccgttgac
agctgcactgaatgcacatgtcagaactcagctaccatatgccgtaaggtatcttgccct
ctgatgccctgtaccaatgccaccattccagatggggaatgctgtcccagatgttggcca
agcgactcagctgatgatgattggtctccatggtcagattggacaccttgctctgtgaca
tgtggacatggcatccagcagagaggacgttcctgcgacagccttaataaccgctgcgaa
ggttcttctgtacagacacgatcttgccatatccaggaatgtgacaagagatttaagcaa
gatggtggatggagccactggtcaccttggtcatcatgctcagttacctgcggaagtggt
caaatcaccagaatccgtctctgcaactcccctgttcctcagctgaatggaaagccatgc
gaaggggaaggaagggagaacaagccatgtcagaaagacccatgcccaattaatggtcag
tggggtccttggtcactgtgggacacatgcactgttacttgcggtggtggaatgatgaag
agggagcgtctctgcaataaccccaaacctcagtatgggggtaaagagtgtattggagat
cctactgattctcagatctgcaacaaacaggactgtcccatagatggatgtctctctaac
ccttgctttgctggagtcaaatgcaccagcttcattgatggatcttggaaatgtggttcc
tgcccaccagggtacagaggaaatggaataacatgcaaagatattgatgagtgcaaagag
gtgcctgatgcctgcttcagcctgaatggagttcatagatgtgagaatacagaaccagga
tataattgtctcccatgccctcctcggttcacaggaactcagccatttggcaaaggcatt
gatgaagctaaagccaataagcaggtttgcaagcctcgcaacccatgcgccgatggtacc
cacgactgtcacaggaacgccagatgtatctaccttggacactacagcgaccccatgtac
cgatgtgagtgcaaacctggatacgcaggaaatggaatcatttgtggcgaagacacagat
ttggatggctggccaaacgagaacctcacatgtgttgctaatgctacctatcactgcatg
aaagataactgccccaacctccccaactcaggccaggaagactatgataaggatggaatg
ggagatgcctgcgataaagacgatgacaatgatggaatcctagatgacagggacaactgt
cagtttgtgtataacccagcacagtacgactatgatcgtgatgacgtgggagaccggtgt
gacaactgcccttacaaccacaacccagaccaggctgacacagaccgcaatggagaagga
gatgcctgtgctgtggacattgatggagatgggatcctaaacgagagggataactgcccc
tatgtgtacaatgtcgaccagagagacacagataaggatggtgttggagaccaatgtgat
aactgcccactggaacacaatccagaacagactgactctgattctgacctcattggcgat
aagtgtgacaacaaccaagatatagatgaggatgggcatcaaaataacctagataactgc
ccctacatccccaatgccaaccaagcagatcatgataaggatggcaagggtgatgcatgt
gaccatgatgatgacaatgatggtgttcctgatgacaaagataactgccgattggtccct
aacccagaccaaacagattctaatggtgatggccgtggagatgcttgccaatatgacttt
gatgatgataacatacccgatgcagaagatgtttgcccagagaatgtggaaatcagcact
actgacttccgtaaattccagatggtgcctttggatcccaaagggacatcacagattgat
cctaactgggtggtgagacaccaaggcaaagaactggttcagactgttaactgtgatcct
ggaattgcagttggttttgacgagttcagtgctgttgacttcagtggcacatttttcatc
aacaccgagagagatgacgattatgccggctttgtgtttggataccaatccagcagcagg
ttttacgtagtcatgtggaagcaaatcactcagacatactgggacacaactcccactgta
gctcagggctactctggcctctcaatcaaggttgtgaactctaccagcggaccaggggag
cacctacgaaatgcactgtggcacacaggaaacacccctgggcaggttcgcaccttgtgg
catgatcctcaccagatcggctggaaagattttacagcttacagatggcacctgacccac
agaccaaagaccggtttcattagagtcgtcatgtatgaaggcaagaaagttatggctgac
tcaggaccaatctatgataaaacatatgctggaggaagattaggattattcgtcttctca
caagagatggtcttcttttctgatctcaaatacgagtgcagagactcttaa

DBGET integrated database retrieval system