KEGG   Xenopus tropicalis (western clawed frog): 100170549Help
Entry
100170549         CDS       T01011                                 

Definition
uncharacterized LOC100170549
Orthology
K06243  
laminin, beta 2
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100170549
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100170549
Cell adhesion molecules and their ligands [BR:xtr04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     Laminin-11 Extracellular matrix (ECM) components
      100170549
   VLA-6
      100170549
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 1853 aa AA seqDB search
MELWEATGLQRTLWESIRAKKFLLIFYLVIGQILGSLAQEPDVLHHGCTEGGCYPATGNL
LIGRAQSLSATSTCGMEEAQEYCIVSHLQDSEKCFACDSRVPYQKESHRIENVIYLTEED
EEKTWWQSENGVESVSIRLDLEAEFHFTHLIMKFKTFRPAAMLIERSADYGRTWKVYRYF
SYNCTKMFPGVPIHALQQIDDIICDQRYSDIEPSSEGEVIYKVLDPAITVEDPYSAEIQE
LLQITNLRINFTKLHTLGDNLLDQRPEVLQKYYYSVYELVVRGSCFCYGHASECSPVEGI
EAGVEGMIHGRCVCKHHTKGLNCEQCQDFYHDLPWRPAEANDPHTCKRCNCNNHSRKCHF
DMAVYLATGKESGGVCDDCQHNTMGRNCELCKPFYYQDPRADIRADNACISCDCDPVGSL
DGGVCDSHTNVNLGMIAGQCRCKGNVKGERCDSCKESFYGLSMNDPVGCQPCSCDPRGII
TGNTPCDQISGDCYCKRFVTGRYCNQCLPEYWGLSNDITGCRPCDCDFGGAYNNKCSLGD
GQCDCRSNIIGRQCGDVQLGYFCMPLDYYTYEAENAKGLSPTDPQLPGSPKPEAQTDCLE
YFNGIQNGKKVRLRRQRRTARVLQQRASQRRARQLQQKPDTEVIRREHNSGHMVTWTGQG
FVRVRDGAGLLFQIDNVPYPMDYDIMIRYEPESAEDWEATVSVTSRILPMSPRCGNVLPS
EQMYKEKLPHTERYLVLPKPFCFESNNQYEISIRFQRWGAANRHPAAFILIDSLVLLPKI
YELPGFHGNDPVSVHHREEMERYMCLDSFKMATMPDLAEMCIKLLCSISAIIHDGALPCL
CDLQGSLSAVCDKIGGQCKCKPNVIGQRCDQCAPGTYGFGPYGCSKCDCHPQGSTSRLCN
PFTGQCPCQSNVAGRQCDQCLPGQWGYPHCRPCVCNGHSDECDSKTGACIRCRDSTTGRH
CEKCLDGYYGDPILGSGQQCRPCPCPGYPGSRNYHGSSCYADKDSHQIVCLCAPGYTGTR
CDRCSPGYFGNPEQEGGECRPCQCNNNIDPTDPESCDSHSGMCMKCLYNTDGAHCEECKA
GFYGSAMQRNCRRCTCNEQGTLQSHCTRDVCYCDRVTGHCPCRANVLGKSCDQCASNFWN
FGGDLGCEPCTCDPAHSLRQDCNVFTGQCHCQPGFGGRVCSHCQENYWGDPQIKCEVCDC
DAYGSETAQCDPLTGKCFCRKGFTGQRCDQCARGFQNNYPRCLPCHECFAQWDMIISQLR
DRLQGVQQKLLDFQEGAVAPEISHSQIKELDNKLRTIEELIKDGGADGMRMLEQMTKLVN
KISSEVAQLSFQLHTQEKQMNGTEAKDRWQRGKLDQLTLDITVVNETVYDLKVQIEAIVA
AGFNESYNSIVKSYLESTEAEKIANGSVYGPGSPVFQSQQTREETERLLKEKLDTYKRNM
TAQKSSLKELQKKVQGLNVSKINEKICGAPGDQECEDSPCGGANCRDEDGKRKCGGDDCN
GALPVSAKALSTAQNITLELENMANRLKDIAQKIQDIQGIAQDAKVQTEATLANAKESKR
RIEDSTEKLREFIKKIKDFLTEEGADPESIELVARQVLNISLPASPGDIEALVNKIKESI
GNLSCTDEILTNTSEILATAKNLHKEAVEAQAKAEAVSANISDAQALLQEAEAKAKSAEK
ALKKAKQSIKDVKSKVEQTMQTLTGVEQKEMDIMERIGNLSEKVDDLLDKTESNRQIASD
AKERANLVLNSTGELRKEMDDVQRKYDDLKEKVGGYNSSSGTALDRIEKIKEEAKALYDK
ANTAKKELAKLEAQFRANEANMTAKILTIEQLENQTTQLLNDIREKSNIYSTC
NT seq 5562 nt NT seq  +upstreamnt  +downstreamnt
atggagttgtgggaagccactgggttgcagaggactctctgggaatccatcagggcaaag
aagttcctgctcatcttctatttagttataggtcagatcctgggatccctcgctcaggag
ccagatgtgctacatcatggctgtacagagggaggctgctatcctgccacagggaacctt
ctcattggtcgcgcccaaagcctcagtgctacatccacctgtgggatggaagaggctcag
gagtactgcattgtcagccatcttcaggactcggagaaatgctttgcctgtgattcccgc
gtcccctaccaaaaggagagccaccgaattgaaaatgtcatttacttgacggaagaagat
gaagagaagacgtggtggcaatctgagaatggagtagaatcagtgagcattcgtctggat
ctagaagcagaattccactttactcatctcattatgaaatttaagacattccgccccgct
gccatgctgatagagagatctgctgattatgggcgtacatggaaggtgtatcgttatttc
tcatacaactgcaccaagatgttccctggggtccccattcatgcactccagcagattgat
gatatcatttgcgaccagcgctattcagatattgagccatccagtgaaggagaggtgatt
tataaagtacttgacccagccataacagtggaggatccatacagtgctgagattcaagaa
cttcttcagattaccaacctgaggataaatttcaccaaactgcacacgcttggagataac
ctgttggaccagaggccggaagttctccagaagtattattactcggtgtatgagttagtg
gtgagagggagttgcttctgttatggacatgcctcagaatgctctcctgtggaaggaatt
gaagcaggagtggaagggatgatccatggaagatgtgtatgtaagcatcacactaagggc
ctgaactgtgagcaatgccaggacttttaccatgatctcccatggagacccgcagaagcc
aatgaccctcacacctgcaaacggtgcaactgtaacaatcactctaggaagtgtcacttt
gatatggctgtgtacctggccactgggaaggagagtgggggtgtatgtgatgactgtcag
cacaacacaatgggacgcaactgcgagctctgcaagcccttctactaccaggacccccgg
gcagacatccgggcagacaacgcctgtatctcttgtgactgcgaccctgtagggtctctg
gacggtggcgtttgtgacagtcacaccaatgtcaacctaggcatgatcgcagggcagtgt
cgctgcaaagggaacgtcaagggggaacgttgtgacagctgcaaggagagtttctatggg
ctgagcatgaacgatcccgttgggtgccagccctgtagctgtgaccctcgtgggattatt
acagggaacaccccatgtgaccagattagcggtgattgttactgcaagcgctttgtgact
gggcgctactgtaaccaatgcctgcctgagtattggggtctcagtaatgatatcacggga
tgccgtccttgtgactgtgattttggaggagcctataacaacaagtgctccttgggagat
gggcagtgtgactgtcgctccaacatcattggtcgccagtgtggagatgtgcagctgggg
tacttctgcatgccactggactactacacgtatgaagccgagaatgccaaggggctctca
cctacagacccccagttacctggttcccccaaacctgaagctcagacagattgcttggag
tatttcaatggtatccagaatggcaagaaagtgaggttgagacgacagaggagaaccgcc
cgtgtcctgcagcagagggcttcccaacggcgtgcgcgccaactccagcagaagccagac
acagaggtaatccgacgggagcacaactcaggtcacatggtcacctggacaggtcaagga
ttcgttcgagtccgagatggagctggtctcttgttccagattgacaacgtcccttatcca
atggattatgacatcatgatccgttatgagccagagtctgccgaggactgggaagcgact
gtcagtgtgacatcacggatattacccatgagcccacgttgtggcaacgtattgccctct
gagcagatgtacaaggaaaagctgccacatacagagaggtacttggtcctcccgaaaccc
ttctgctttgaaagcaacaaccagtatgaaatcagcatccgattccagcgctggggagct
gccaaccgccaccccgccgccttcatactcattgactcgctggtccttctgcccaagatc
tatgagctccccggcttccatggaaatgaccctgtgtcagtgcatcatcgggaagagatg
gaacgatacatgtgcctggattccttcaagatggccaccatgcctgacctggcagaaatg
tgcatcaagcttctctgcagcatctctgccatcatccacgatggagctctgccctgcctg
tgtgacctgcagggttcccttagtgctgtctgtgacaagataggaggacagtgcaagtgt
aagcctaatgtgattggccagcgctgtgaccagtgcgctccagggacctatggatttggc
ccatatggatgcagcaaatgtgactgccaccctcaaggttccacctccaggttatgcaat
ccctttacagggcagtgcccgtgtcagagcaatgttgccggcagacagtgtgaccagtgc
ttgccaggccagtggggctaccctcactgtaggccgtgcgtatgtaatggccattctgat
gagtgtgactccaagactggggcctgcatcagatgcagagattccactaccgggcgccac
tgtgagaagtgtttggatggatattatggggaccccatactgggctctggtcaacaatgc
cggccatgtccttgcccggggtatcctggcagtcgcaattaccatggcagctcctgctat
gctgacaaggattcccaccaaattgtgtgcctctgtgcgcctggatatacagggactcgc
tgtgaccgctgctcccctggttactttgggaaccctgaacaggaaggcggggagtgccgg
ccgtgtcagtgcaacaacaacattgaccccactgaccctgagtcatgtgactctcatagc
gggatgtgcatgaagtgcctctacaacacagatggagctcactgcgaagagtgcaaagct
ggtttctatggcagcgccatgcaacgaaactgccgccgatgtacatgcaatgagcaaggc
accctgcagtcccactgcaccagagacgtctgctattgtgaccgggtgactgggcattgc
ccctgcagagccaatgtgctgggcaagagttgcgatcagtgtgcctctaacttctggaac
tttgggggggacctcggctgcgagccctgcacctgtgacccagcccactccctccgacag
gactgcaatgtgttcacaggacaatgtcactgccagcccggctttggggggagagtctgc
tcacactgccaagagaattactggggtgacccccaaattaaatgtgaagtatgtgactgc
gatgcatacgggtcagaaacggcgcagtgcgaccccctcaccggaaagtgtttctgtcgg
aaaggtttcacgggacagagatgtgatcagtgcgccaggggcttccagaacaattatccc
cggtgcctgccctgccacgagtgtttcgcccaatgggacatgatcatctctcagctccgg
gatcgactccagggcgtccaacagaaactgttagacttccaggagggagcagtagcccca
gagatcagtcacagtcagattaaagagttggataacaagctgaggaccattgaagagctc
attaaagatggaggtgctgacggaatgcgaatgttggagcaaatgaccaaactagttaac
aaaataagttctgaagtggctcagctctcatttcagctacacactcaggaaaagcaaatg
aacggcacggaggcgaaggaccgatggcagaggggaaagctggaccagctgacgttagat
attactgttgtgaatgagacagtgtatgatctgaaagtgcagatagaggccatagtagcg
gcaggattcaatgaatcatacaacagcatcgtgaagtcgtatttagaatccacggaggca
gagaagattgccaatggctctgtgtatggtccgggaagtcctgttttccagtcgcagcaa
acaagggaagaaactgagaggcttctcaaggagaaacttgacacatacaaaagaaacatg
actgctcagaagagctcattgaaggagctgcaaaagaaggtccagggactcaatgtttcc
aaaatcaatgagaagatctgcggggccccaggagaccaggaatgtgaggactcgccatgt
gggggagcaaactgtagagatgaagacgggaagagaaaatgtgggggcgacgactgtaat
ggagctctgccagtttctgcaaaggcccttagcacagcgcagaacattaccctggagctg
gagaacatggccaacaggctgaaagacattgctcaaaagatacaagatatccagggaatt
gctcaagatgccaaggtccagacagaagccacactggccaacgccaaagaatccaagcgc
cgtatagaggattcaacagagaagctacgggaatttattaagaagattaaagattttcta
actgaagagggtgctgatccagaaagcattgagttagtggctcgacaagtcttgaacatc
tctctgcccgccagtcctggcgacattgaggcactggtcaataagatcaaagaaagtatt
gggaacctcagctgcaccgatgagatcctgaccaacacctctgaaatcttggccactgcc
aagaacctgcacaaagaggccgtggaggcacaggccaaggccgaggctgtgagtgcaaat
atatctgatgcccaggcgctgctacaggaggcagaggccaaagccaaatctgcagagaaa
gctttaaagaaggccaagcagagcattaaagatgtgaaaagcaaagtggaacagaccatg
cagaccctgactggagttgaacagaaagagatggacattatggaacgaataggaaatctc
tctgagaaagttgacgacttgctggataagactgagtccaacaggcaaatagccagcgat
gcaaaagaaagagccaacttggtcctcaattccactggggagctgagaaaggaaatggac
gacgttcagaggaagtacgatgatctgaaagagaaggttggcggttacaacagctcgtct
ggcaccgccctggacaggatagagaagataaaggaggaggccaaagctctgtatgataaa
gcaaatacagccaagaaggagctcgcaaaactagaagcacaattcagggccaatgaagcg
aacatgacggccaagattcttacgatcgagcaactggagaatcagacaacgcaactgcta
aatgatatacgagagaagtccaatatatactccacctgctaa

DBGET integrated database retrieval system