KEGG   Xenopus tropicalis (western clawed frog): 100170605Help
Entry
100170605         CDS       T01011                                 

Gene name
rptor, raptor
Definition
(RefSeq) regulatory associated protein of MTOR, complex 1
  KO
K07204  
regulatory associated protein of mTOR
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Autophagy - other
Autophagy - animal
mTOR signaling pathway
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    100170605 (rptor)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100170605 (rptor)
   04136 Autophagy - other eukaryotes
    100170605 (rptor)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100170605 (rptor)
Membrane trafficking [BR:xtr04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    100170605 (rptor)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
Position
10
AA seq 1288 aa AA seqDB search
MELHTPALGLVGEDEETDLSDWNLPSAFMKKRHCEKIEGCKSLAQSWRMKDRARYKQSLD
PTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKNYTQYIPLSIYDLQT
WMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPSHPLAQMPLPPSMKNCIQLA
ACDAAELLPMNPDLPADLFTSCLTTPIKIALRWFCMQKSVRLVPGVTLDLIEKIPGRLND
RRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCSP
VSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWLTMGV
ENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQSSA
RELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTSFILAVIVN
NYNTGQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQNFDAARWCGVRDSAHEKL
YSLLSDPMPEVRSSAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLINDGSPMVRKELV
VALSHLVVQYESNFCTVALQFMEEEKNYPLPSPASTEGGSLTPIRDSPGTPRLRSVSSYG
NIRAVTTPRNLNKSLQNLSLSEETGSAITFSPGNLSTSSSASSTLGSPDNEEYILSFETI
DKMRRVSSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPEVSDLAMKVLNSIAHKATVN
ARPQRILDASSLTQSAPASPTNKGMHIHQVGGSPPTPSASSSSLTNDVTKPPVSRDIPSN
RPANAGGNVGVQYTPHSHQFPRTRKMFDKGPDQPGDDGDEAIVHKNFTVGSFQTGFCDWS
AKYFAQPVMKMPEEHDMESQVRKEREWRFLRNTRVRKQAQRLIQKGISRLDDQIFINRNP
GVPSVVKFHPFTSSIAVADKDSICFWDWEKGEKLDYFHNGNPRYTRITAVEYLNGQDCSL
LLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGLARRVSIYLDRSKQGGAGM
VVDWEQETGLLITSGDVRIIRLWDTDRETKVQDIPTGADSCVTSLSCDSHRSLIVAGLGD
GSVRVFDRRMALNECRVMTYREHSAWVVKTSLQKQSDGNIVSVSVNGDIRYFDPRMPECL
NSLQIVKGLTALDIHPQANLFACGSMNQFIAIYNGNGELISNIKYYDGFMGQRIGAISCL
AFHPYWPHLAVGSNDYYMSIYSVEKRAR
NT seq 3867 nt NT seq  +upstreamnt  +downstreamnt
atggagctgcacaccccggccctgggactagtcggggaggatgaagaaaccgatttgagc
gattggaatttgccgtctgcgttcatgaagaagcggcattgtgagaagatcgaaggctgc
aagtcacttgcacagagttggaggatgaaagatcgggctcggtacaaacagagtctagat
ccaactgtggatgaggttaaaaaactctgcacttcgctgagaagaaatgccaaggaggaa
agggtgctgttccattataatggacatggggttccccgacctacagtcaacggggaaatc
tgggtctttaataagaattacacacagtatattcctctttctatatatgacctacagacc
tggatgggaagcccatctatctttgtatatgactgctcaaatgccggcctcattgtcaag
tctttcaagcaatttgcactacagagagagcaagagcttgaggttgctgctattaaccca
agccacccattagcacagatgccattgccaccatcaatgaagaattgcatccagttggca
gcttgtgatgcagctgaacttttgcctatgaaccccgaccttcctgctgaccttttcacg
tcttgcttgaccacacctattaagattgccctgagatggttttgtatgcagaaaagtgtg
cgattggtgcctggtgttactctggatcttatagagaaaattcctgggcgattaaatgat
aggaggacaccactgggagagctgaactggatctttacagcaatcacagatactatagca
tggaacgttctgcctagagacctatttcagaagctctttagacaggacctattagttgcc
agtctcttccggaactttcttctggccgagaggatcatgagatcatacaattgcagccca
gtgagcagccctcgtttgccacccacctacatgcatgctatgtggcaggcatgggatctt
gctgtcgatatatgtctttctcagctacccaccattattgaggagggaactgctttccgg
cacagccctttctttgctgagcagctgactgcatttcaggtgtggctgactatgggtgtt
gagaacagaaaccccccagaacagttgcccattgtgctgcaggttttgctgagccaggtt
catagactccgtgccttggacctcttgggaagattcttagatctgggtccctgggctgtc
agtctggccctctctgttggtattttcccttatgtgctaaagctgctccaaagctcagct
cgggaactccggccactgcttgtctttatttgggccaagatccttgctgttgatagttcg
tgccaagcagacttagtaaaagataatggccataaatattttctttctgttctggcggat
ccatatatgccggctgagcaccgtacaatgacctccttcattttagcagtaattgttaac
aattataacactggccaggaagcctgcctccaaggaaacctgatcgctatctgcttggag
cagctaaatgatccacaccctctcctacgccaatgggttgctatctgcctgggacgcatc
tggcagaattttgatgctgcacgttggtgtggggtacgtgatagcgcccatgagaagctg
tacagcctcttgtctgaccccatgccagaggtccgtagttctgcagtttttgcccttggc
accttcgttgggaattcagctgagagaacagatcactctacaacaatagatcacaatgtt
gcaatgatgttagcacagcttatcaatgatgggagtcctatggtgcgcaaggagcttgtt
gtagctcttagtcatctggttgtgcagtatgaaagtaacttctgtacagttgccctccag
tttatggaggaagagaagaattaccccctgccctcgccagcttccacagagggaggcagt
ttgacaccaatacgagatagccctggaacgccccgcttgagatctgtgagctcctacggt
aatatccgggcagtgacaactccaagaaacttgaacaagtctctgcagaatctaagcctg
agtgaagagactgggagtgccattacattttctcctgggaatctaagtacaagtagtagc
gcaagcagtacgttaggaagcccagataatgaagagtacatcttgtcctttgagaccatt
gataagatgaggcgtgtcagttcttactcctctctcaattccctcataggtgtctcgttc
aatagtgtctacactcagatttggagagtgcttctccaccttgctgctgacccataccct
gaagtctcggaccttgcaatgaaagtgctaaacagcattgctcataaggctacagtgaat
gctcgcccacagcggatcctcgatgcctcctcactcacgcagtctgctccagccagtccc
accaacaaagggatgcacattcaccaagtgggtggttcccctccgactcccagtgccagc
agttccagtctcaccaacgatgtaacgaaaccacctgttagtagggatattccctctaat
cgacctgccaatgctgggggcaatgttggggtgcagtacacgcctcattcccaccagttt
cctcgtacaaggaaaatgttcgacaaaggaccagaccagcctggagatgatggagatgaa
gccattgtacacaagaactttactgtaggatcttttcagacaggcttttgtgattggagt
gccaaatattttgcccagccagtcatgaagatgccagaggaacatgacatggagagtcag
gtacgtaaagaacgagagtggcgatttctacgaaatacaagggtacggaaacaggcccag
cgccttatacagaaaggaatctcaagactcgatgaccagatctttatcaaccggaatcca
ggagttccttctgttgtgaagttccatccttttacctcaagcattgctgtagcagacaag
gacagcatttgtttctgggactgggagaaaggagagaagctggattactttcacaatggt
aaccctcgttatactcgtataacagcagtcgaatatctgaatggccaggattgctctttg
ctgcttactgctacagatgatggagccatccgcgtgtggaagaactttgctgacttagag
aaaaatccagagatggtgacagcttggcagggactgtccgatatgctgccgaccacacga
ggcctggctcgaagagtttccatttatcttgacaggagtaaacaggggggggctggcatg
gtggtggattgggagcaagaaacaggtctactcatcacatctggagacgtgcgaattatc
cggctatgggacacagacagagagacaaaagtgcaggatatacccactggagcagacagt
tgtgtgaccagcctgtcatgtgactctcatcgttcccttattgtggctggactcggagat
ggttcagtgcgagtgtttgatcgcaggatggcactgaatgaatgccgtgtaatgacgtac
cgagagcactcagcctgggtagtaaagacttctctccaaaagcagtccgatgggaatatt
gtgagcgtcagtgtaaatggagatatccgttacttcgaccctcgtatgccagaatgttta
aactcactgcagattgtgaagggtcttactgcgttggatatccacccacaggctaacctg
tttgcatgtggttcaatgaaccagttcatcgctatttacaatggaaatggagagctgatc
agcaacataaagtactacgatggatttatgggacaaagaataggagccattagctgcctg
gcctttcatccttactggccccacctggccgttggcagtaatgactattatatgtctatt
tactcagtggagaagcgagcgagatag

DBGET integrated database retrieval system