KEGG   Xenopus tropicalis (western clawed frog): 100192373Help
Entry
100192373         CDS       T01011                                 

Gene name
acacb
Definition
acetyl-CoA carboxylase beta (EC:6.4.1.2)
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Insulin signaling pathway
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100192373 (acacb)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    100192373 (acacb)
   00640 Propanoate metabolism
    100192373 (acacb)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    100192373 (acacb)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    100192373 (acacb)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100192373 (acacb)
Enzymes [BR:xtr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     100192373 (acacb)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     100192373 (acacb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 2387 aa AA seqDB search
MEGDKEQLPKPPIAEAETPAESDDNLLRTQAEGTTSGQIQDTNSGVNSGTLPPRAASLSK
PEQKQLKFAPSRGTEPVNPKPRKQPLSKFILGSSEDNSDDDEFACGSFKTTKRNSQASLG
SQTPSLSSLPETESLPTMRSSMSGLHLVKKGRDHKKLDLHRDFTVASPHEFVTRFGGNRV
IEKVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVP
VPGGPNNNNYANVELIVDIAKRIPVQAVWAGWGHASENPKLPELLQKQNIAFLGPPSQAM
WALGDKIASTIVAQAVGIPTLSWSGDGLLLELKPDDKQQQNIICVPPEVYEKGCVKDADE
GLEAAERIGYPVMIKASEGGGGKGIRMAERAEDFPSLFRQVQTEAPGSPIFVMKLAQHAR
HLEVQILADQYGHAVSLFGRDCSIQRRHQKIIEEAPATVATPSVFEYMEQCAVRLAKMVG
YVSAGTVEYLYSEDGSFHFLELNPRLQVEHPCTEMICDVNLPAAQLQISMGVPLYRIKDI
RVLYGETPWGDSPICFENPVNAPNPRGHVIAARITSENPDEGFKPSSGTVQELNFRSSKN
VWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIK
LLETESFQNNEIDTGWLDHLIAEKVQAEKPDTMLGVVCGALNVADALFQTCMNEFLHCLE
RGQVLPAASLLNIVDVELISERVKYKLKVARQSLTTYVIILNNSHIEIDVHRLSDGGLLL
SYDGNSYTTYMKEEVDRYRITIGNKTCVFEKENDPTVLRSPSTGKLLQYTVEDGSHVNAG
ECFAEIEVMKMVMALTVQEPGQIHYVKRPGAVLESGCMVAQIDLDDPSKVLQAEPYTGSL
LPQQTLPIIGEKLHQVFHSVLENLINVMNGYCLPEPYFTVKIKEWVHKLMKTLRDPSLPL
LELQEIMTSVSTRIPPTVERSIRKIMAQYASNITSVLCQFPSQQIASILDSHAATLQRKA
DREVFFMNTQSIVQLVQRYRSGIRGYMKSVVLDLLRRYLQVETQFQHSHYDKCVIHLREQ
YKPDMTPVLECIFSHAQVAKKNFLVTMLIDQLCGRDPTLTDELMAILNELTQLSKTEHSK
VALRARQVLIASHLPSYELRHNQVESIFLSAIDLYGHQFCPDNLKKLILSETSIFDVLPN
FFYHNNQVVRMAALEVYVRRGYIAYELNSLQHHQLRDCTCVVEFQFMLPSSHPNREISPT
LSRMSLPISATHLEINRQSSELFMDSGFSPLCQRMGVMVAFNKFEDFTRNFDEVISCFAD
PPLDSPLFSEVRSSFYDEEDNKNIREEPIHILNVALKSVDRMEDEELVSVFRTFCQSKKN
ILVDYGLRRITFLIAQQREFPKFFTFRARDEFAEDRIYRHLEPALAFQLELNRMRNFDLN
AVPCANHKMHLYLGAAKVAAGIEVTDYRFFVRAIIRHSDLITKEASFEYLQNEGERLLLE
AMDELEVAFNNPSVRTDCNHIFLNFVPTVIMDPSKIEESVRSMVMRYGSRLWKLRVLQAE
VKINIRLTPTGKAIPIRLFLTNESGYYLDISLYKEVTDPATGQIMFHSYGDKHGHMHGML
INTPYVTKDLLQSKRFQAQSLGTTYVYDFPEMFRQALFKLWRSGEKYPKDILTYTELVLD
TQGQLVQLNRLPGGNEVGMVAFKMNLKTPEYPNGREIIVICNDITYKIGSFGPQEDLLFL
KTSELARKEGIPRIYIAANSGARIGLAEELRHMFQVAWNNPSDPYKGFKYLYLRPQDYTK
ISSMNSAHCEHVEDEGESRYVLTDIIGKEEGIGVENLRGSGTIAGESSLAYKEIVTIGMV
TCRAIGIGAYLVRLGQRVIQVENSHIILTGASALNKVLGREVYTSNNQLGGVQIMCNNGV
SHTMVPDDFEGVYTILQWLSYMPKDNQSPVPVIPPMDPVDRQIEFMPTKAPYDPRWMLAG
RPHPTIKGEWQRGFFDHGSFMEIMQRWAQTVVVGRARLGGIPVGVIAVETRSVEMAVPAD
PANLDSEAKIIQQAGQVWFPDSAFKTAQAIKDFNRERLPLLIFANWRGFSGGMKDMYDQV
LKFGAYIVDSLREFKQPVLVYIPPYAELRGGSWVVIDPTINPLYMELYADKDSRGGVLEP
EGTVEIRFRKKDLIKTMRRIDPVYTQIVEQLGSPELTEGERKELEKKLRLREEQLLPIYH
QVAVRFADLHDTPGRMQEKGVITDILEWKDARSFLYWRLRRLLLEEMVKSEILHANSELS
DIHIQSMLRRWFMETEGAVKTYLWDNNQVVVEWLEKHLQEEDEARSAIRENIKYLKKDYA
LKHIRGLVQANPEVAMDCIVHMTQHITPAQRAQLTRLLSTMDNTPPS
NT seq 7164 nt NT seq  +upstreamnt  +downstreamnt
atggaaggtgacaaagagcagttgccaaaaccaccaatagcagaagctgaaactccagct
gagtcagatgacaatcttctcaggacccaagcagaaggaactacctcaggtcaaatacaa
gacacaaactcaggagtcaattctggcactttaccaccacgtgcagcatctctctccaaa
ccagagcagaagcagctgaaatttgcaccctcaagaggtacagaacctgtaaatccaaag
ccaaggaagcagccattgtctaaattcatcctgggctcctcagaggacaactccgatgat
gatgaatttgcctgtggatcgtttaaaactacaaagagaaacagccaggcaagccttggt
tctcagactccatctttatcttccttgccagaaacagaatcattacctactatgaggtcc
agcatgtctgggttacaccttgtgaagaagggcagagatcacaagaagctggatctccat
agggacttcactgttgcttcaccgcatgaatttgtaacacggtttggtgggaaccgggtt
attgaaaaggtcctcatagccaacaatggcattgcagcagtcaagtgcatgcgttccatc
cggagatggtcatacgaaatgttcaggaatgaaagagcaatccgtttcgtggtcatggtt
accccagaagacctcaaagctaatgcagagtacatcaaaatggctgatcactatgtgcca
gtcccaggaggacccaataacaacaactatgctaatgtagaactaattgttgacattgcc
aaacgaataccagtacaggctgtgtgggctggatggggacatgcctcagaaaatccaaaa
cttccagagctcctgcagaaacagaacattgcgttcttggggcctcccagccaggccatg
tgggccttaggagacaagatagcctctacaattgttgctcaggctgtgggaatcccaact
ctttcatggagtggtgatggtctcctactagaattaaaaccagatgacaagcaacaacaa
aatattatttgcgttcctccagaggtgtatgaaaaaggctgtgttaaagatgcagatgaa
ggacttgaggctgcagagagaattggatacccagtgatgattaaggcatcagaaggtggc
ggggggaaaggcatccgaatggctgagcgagctgaggattttcccagtctatttagacag
gtgcaaacagaggccccaggatcacccatttttgttatgaagcttgctcagcatgcccga
cacttggaggtccagatattggcagatcaatatggtcatgctgtgtctctgttcggacgg
gattgttccatacagcgacgacaccaaaagataattgaggaagctcctgccactgtggct
accccatctgtatttgagtacatggaacaatgtgcagtgcgtcttgccaaaatggtgggg
tatgtgagtgcaggaacagtagagtacctgtacagtgaagatgggagctttcatttcttg
gaactcaaccctcggcttcaagtggaacatccctgcactgaaatgatctgtgatgttaac
ctcccagctgctcaactccagatttcaatgggagttcccttgtacaggataaaagatata
cgagtgctgtacggagagacaccatggggagattcacccatttgctttgagaaccctgtg
aatgcaccaaatcccagaggccacgtcattgctgctaggataaccagtgagaacccagat
gaaggttttaagccaagctctgggaccgtccaggaactaaactttcgcagcagtaagaat
gtttggggatatttcagcgtagcggctgctggcggtcttcatgaattcgctgattcccaa
ttcgggcattgcttctcctggggagagaaccgtgaagaagctatctcgaacatggttgta
gctcttaaagagctgtctatccggggagactttagaactactgtggaatacctcattaag
ttgctggagacagagagcttccagaacaatgaaattgacactggctggctggatcaccta
atcgctgagaaagtccaggcagaaaaaccagacacaatgcttggagtagtatgtggtgca
ctaaatgtggcagatgctttgttccagacctgtatgaatgagtttctgcactgcctcgag
agaggccaggtacttccagcagcttcacttctgaacattgttgacgttgagctaatttct
gagcgtgttaaatataaactgaaggttgcccggcagtcccttaccacctatgtgataatc
ctgaataactctcacatagagatagatgtgcaccgcttgagtgatggggggcttctcttg
tcctacgacggcaatagttacactacatacatgaaggaggaagttgaccgataccgaata
actattggaaacaagacttgtgtttttgagaaggagaatgaccccacggtgctacgatca
ccctctactggcaaattgcttcaatacacagtggaggatggttcccatgtgaatgctggg
gagtgctttgcagaaattgaggtaatgaaaatggtaatggccctgactgtgcaggagcca
ggtcagatacattatgtgaaacgtcctggagctgttctggagtcaggctgtatggtggct
caaattgatttagatgatccatctaaagtcctccaggcagagccgtacactgggagcctc
ttgccgcagcaaactctgccgattattggagagaagctccaccaggtttttcacagtgtt
ctggaaaatctgattaatgtgatgaatggttactgcttgcctgagccctacttcactgtc
aagataaaagagtgggtgcacaaactaatgaagacattgcgagacccttctctccctctt
ctggagctgcaggaaatcatgaccagtgtttctaccagaattccacccactgtagagcgg
tccatacgcaaaattatggctcagtatgccagtaatatcacctctgtcctgtgccagttc
cccagccagcagattgcaagtattctggacagccatgctgcaacattgcagaggaaagca
gaccgggaagtgttttttatgaatacccagagtattgtgcaacttgtacagagatatcgc
agtggaatccgtggctacatgaaatctgtggtacttgatttgctaagaagatacttacaa
gttgaaactcagttccaacactctcactacgataaatgtgtgatacatctgcgggaacag
tacaagccagacatgacccctgttctggaatgtattttttcacatgcccaggtggctaaa
aagaactttcttgtcaccatgctaatagatcaactttgtgggcgtgaccccacacttact
gacgagttaatggctattctcaacgagctgacgcaactgagtaaaactgagcactcaaaa
gttgcactcagggcacgtcaggttctgattgcttcccatcttccctcatatgaactgaga
cacaatcaggtggaatctattttcctctctgctattgatctgtatggacatcagttctgc
ccagataacctaaagaaactgatcttgtcagaaacctcaatttttgatgtcctcccaaac
ttcttctatcacaataaccaggttgttcgaatggctgcactggaggtgtatgttagaaga
ggttatattgcctatgaacttaacagcctccagcaccatcagcttcgtgattgcacctgt
gtagtggagttccagttcatgctaccatcctctcaccctaacagagagatcagcccaaca
ctgagcaggatgtctctgccaatcagtgcaacgcatcttgagattaatcgccagagcagt
gaacttttcatggacagtggcttctctcctctgtgtcaaaggatgggggtcatggttgct
tttaataagtttgaggactttaccaggaactttgatgaggtcatttcctgctttgcagac
cctcctctggacagtcctctgtttagcgaagtcagatcttccttttatgatgaggaggac
aataagaatatccgggaggagccaattcacattcttaatgtggctttaaagtctgttgat
cgcatggaagatgaagaactggtgtctgtgtttagaacattctgtcagtctaagaaaaac
atcttggttgattacggacttcgcagaatcacatttttgatagcccaacagagagagttt
ccaaaattcttcacattcagagcaagagatgagtttgccgaagaccgaatatacaggcac
cttgagcctgcccttgccttccagttagaactaaatcgaatgcgtaattttgacttaaat
gcagtgccatgtgccaaccacaaaatgcatctctatcttggagcagctaaagtagcggca
gggattgaagtgacagactacagatttttcgtacgagccataattcgccattctgacctg
attacaaaggaagcttcctttgaatacctacagaatgaaggagagcgtcttcttctggag
gccatggatgagctagaagttgccttcaacaatcccagtgttcgcactgattgcaatcac
atcttcttgaactttgttcccactgtcattatggacccttccaagattgaggagtcagtc
cgctctatggttatgagatacggaagcagattgtggaagctgcgtgtccttcaagctgaa
gtcaaaatcaacattcgcttaacccccacaggcaaagccatccccattcgcctattcctg
acaaatgagtctgggtattacctagatatcagcctctacaaggaggtgacagatcctgcc
actggacaaatcatgtttcattcatatggggataagcacggacacatgcatggcatgttg
atcaacacaccatatgtcaccaaagacttgctgcagtccaaaaggtttcaggcccagtcc
cttggaactacttatgtgtatgacttcccagagatgttcagacaggctctgtttaaactg
tggcgctcaggagagaagtaccctaaagatattcttacgtacacagagctggttttggac
acccaaggtcagctggtccagttaaacagacttccaggtggaaatgaggttggaatggtg
gctttcaaaatgaatttgaaaacccctgagtatccaaatggccgtgagattattgtcatc
tgcaatgatattacctacaagattggctcctttgggccacaagaagatctgcttttcctc
aaaacttcagagttggccagaaaagaaggcattccacgtatttacattgcagccaatagt
ggtgcccgtattgggctggcagaggagctgcggcacatgtttcaggtggcttggaacaat
ccttctgacccttataagggtttcaaatatctttatttgaggcctcaagactacacaaaa
atcagctccatgaactctgcacactgtgagcacgtggaggatgaaggagaatcaaggtat
gttttgactgacattatcgggaaggaggaaggaattggagtagaaaatcttcgaggctca
gggacaatcgctggagaatcatccttggcttataaagagattgttactattggcatggtg
acttgcagagccattggaatcggggcctatttagtgaggttgggtcagagagttatacag
gtggagaactcacatatcattctgacaggagccagtgcgctgaacaaggttctgggccga
gaagtctacacatcaaataaccagcttggcggtgtgcagatcatgtgcaacaatggagtg
tctcacaccatggtacctgatgattttgagggagtgtataccattcttcagtggctttcc
tacatgccaaaggataaccaaagtcctgtgcctgttattccccctatggacccagttgac
cgtcagattgagttcatgccaaccaaggctccctatgatcctcgctggatgcttgccggg
agaccgcatccaactatcaaaggagaatggcagcgaggcttttttgaccatggaagcttt
atggagatcatgcagcgctgggctcaaactgttgttgttggcagggcacgacttggagga
atacctgtaggtgtaattgctgtggagactagaagtgtggaaatggcagtgcctgctgat
ccagccaatctggattctgaagccaagattattcagcaagctggacaggtttggttccca
gactctgcctttaaaactgcccaggcaataaaggatttcaacagggagagactgccactt
cttatatttgcaaactggcgtggattttccggaggaatgaaagacatgtatgaccaagtg
cttaagtttggagcatatattgtggacagcctgcgggagtttaagcagccagtgctggtg
tacataccaccgtacgctgagctgagaggaggatcatgggttgttatagatccaactatt
aacccactctatatggaactgtatgcagacaaggacagcaggggtggtgtcttggaaccc
gagggcacagttgagattcgttttagaaagaaagacctgataaaaacaatgagaaggata
gaccctgtgtatacccaaatagtagaacagctcggtagcccagagctgactgagggagaa
cgtaaagagctggagaagaaactaaggttgagagaggagcagctactccctatttaccac
caagttgctgtgcgatttgcagatctccatgatacaccaggcaggatgcaggagaaaggt
gtcatcacagatattctggaatggaaggatgctcgatccttcctctactggaggctacgg
cgccttctcctggaagaaatggtgaaaagtgagatcctccatgcaaacagcgagctcagc
gatattcatatccagtctatgctgcgtcgatggtttatggagactgagggagctgtaaag
acttacctatgggacaataaccaggttgtggtggagtggttggagaagcacttacaagag
gaagatgaggcacgatctgcaatccgagagaatataaaatacctaaaaaaagactacgct
ctaaaacatatccggggtttggttcaagcaaaccctgaagtagccatggactgcattgtt
catatgactcaacatatcactccggcacagagagctcagttgaccaggcttttatctacc
atggacaataccccccccagctaa

DBGET integrated database retrieval system