KEGG   Xenopus tropicalis (western clawed frog): 100216035Help
Entry
100216035         CDS       T01011                                 

Gene name
whsc1l1
Definition
Wolf-Hirschhorn syndrome candidate 1-like 1 (EC:2.1.1.43)
Orthology
K11425  
histone-lysine N-methyltransferase NSD3 [EC:2.1.1.43]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100216035 (whsc1l1)
Enzymes [BR:xtr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100216035 (whsc1l1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 582 aa AA seqDB search
MDFSFSFMQGIMGNTIQQPPQLIDSANNRQDDANSSDQADEGGGTPYDSGLQPDFQYPTP
TTEDLPPLTNGYQPSLGYEPQGKYYSQFPNGSANGYGTRNFTALEYYHLETAALRPVEGM
SKASPPQPTSPPTLLQAPPLSTTTPQKKTGSPEIKLRITKTIQNGREMFESSLCGDLLHE
FHASEMTKKKHERRKERREKRKKSRHHHHHHHHHHHREEVKAEEQQPPKMKKLEPPPEEE
RVQKHLPVSPLSPEVRTGVWFHVGDLVWSKVGTFPWWPCMVSCDPQLHVHSKINTRGARE
YHVQFFSSEPERAWVHEKRMKEYRGEQQYEQLVAEDSAKACNQSEKLKMRKPRPQRERVQ
WEIGIAHAEKALRMTREERIEQYTFIYVDEEKPPEPKKPVNIGKKSRRSTSSSEPESNRL
SEVLPSPPRQPSAPSPISHNNKDSPAEHRRQSQRKPPHEEEHPPQPPPAKTPWKTAAARK
SLPASVLLHKGTLDLQKCNMSPVVKIENVLALQNATSEGFEQFIYTTKEVGNKTEITVKA
PERAFAPSPNQKSEKSSAQHTPAPETSGATGRHNMKLHVSTP
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atggatttctccttctctttcatgcaagggatcatgggaaacacaatccagcaaccacct
caactcatcgactccgccaacaaccggcaggatgatgccaacagcagtgaccaggctgat
gagggtgggggcacaccctacgattctggcctgcagccggacttccagtacccaaccccc
accactgaggatttgcctcctcttactaatggctaccaaccttcactgggatatgagcca
caaggcaaatactattctcaatttcctaatggctcagccaatggatacggtaccaggaac
tttaccgctttggagtattatcatctggagactgcagctttacggcctgttgaaggaatg
agtaaagcatctccacctcagccaacttcccctcccaccctcctccaagctcccccgttg
tccactaccacccctcagaagaagacgggctcccctgaaattaagttgcgaatcactaag
actattcaaaatggccgtgagatgtttgagtcttcactgtgtggagacctccttcatgaa
tttcatgccagtgagatgaccaagaaaaaacatgaacggaggaaagaaaggcgagagaag
aggaaaaagagccggcatcatcatcaccatcaccaccatcatcaccaccgcgaagaggtg
aaagctgaagagcagcagccacccaagatgaagaaactggagcctcctccagaggaggag
cgtgtacagaagcacttacccgtttccccactatcccctgaagtcagaactggtgtttgg
ttccatgtgggagacttagtttggtctaaagtggggacgtttccttggtggccctgtatg
gtgtcctgtgaccctcagttacatgtccacagcaagatcaacacgagaggggctcgagaa
taccacgtgcagtttttcagcagtgagcctgagagggcctgggtacatgagaagcgcatg
aaggagtaccggggagaacagcagtacgagcagctggtagcagaagactctgctaaagcg
tgcaaccaatcagagaagctcaagatgagaaaaccaaggccccagcgagagcgtgtgcag
tgggagataggaattgcccatgcagagaaggcattgcggatgacacgggaggagaggata
gagcaatacacctttatctacgtagatgaggaaaaaccccctgaacccaaaaaacctgta
aacataggcaaaaagagtcggcggtccacctccagcagtgagcccgagtcaaaccgcctg
tctgaagttttaccctcacctccccgacagccttccgccccatctccgatctcacataac
aataaagactctccggcggaacacaggaggcaaagtcagaggaaaccgccgcacgaagag
gagcatccgcctcagcctccaccagcaaaaacgccatggaagacagcagccgctcgtaag
tcgcttcctgcttcagtgctactgcataagggtacgcttgatcttcagaagtgcaacatg
tcccctgtggtgaaaatcgagaatgtccttgctttacagaatgctacatctgagggattt
gaacagttcatatacacaacaaaggaagtcggtaacaagacagaaattactgtcaaagcc
ccagaaagggcgtttgcaccctcccccaaccagaagtcagagaaatcctcggcacagcac
acgcctgctcctgaaacatcgggggccacaggtaggcacaatatgaaactgcacgtgtct
accccctaa

DBGET integrated database retrieval system