KEGG   Xenopus tropicalis (western clawed frog): 100216061Help
Entry
100216061         CDS       T01011                                 

Gene name
eea1, zfyve2
Definition
early endosome antigen 1
Orthology
K12478  
early endosome antigen 1
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Endocytosis
Phagosome
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:xtr04144]
Cellular Processes; Transport and catabolism; Phagosome [PATH:xtr04145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 1402 aa AA seqDB search
MFRRILQLTPGRVGSQNSESDSSATPGNAESSSEGFICPLCMKSHATAEELFVHYEASHE
PANDPGQGGQTNLSPKRDEVLLLRQEVKDLQTSLKEEKWFSEELKKELENVQGQLKQNTI
SDGMTTIAATELQSLEQKLEEAQTEMFNIKQMKDLFEQKAAQQATEVVDLKASYDEEKSN
LAAAREKVKGLTQDLDSKLHVIEDLKNELLQRPGIEDVAVLKKELVQVQTLMDKTTLDAE
NESEKLKDECRQLQAQISNSEVTITQLKAELAKGPQEVAVYVQELQQLKTALTELNQKHD
SLMEKFLKKELDYTQLEEKQNEESTARKNLQVLLNQKDVEFQQLQARFSARDMSLQTVKA
EVGEKAETNQKLKAELSEVETKYQHLKAEFKQLQQQREEKEQLSLQQQSEINQLHSKLLE
TERQLGEAHGRLKEQRQLSAEKLMDKEQQVADLQLKLSRAEEQLKEKTSASTDLQHQLEK
IRQQHQEQTNLQQNTTSKLREAQNDLEQVLRQIGDKDQKIQNLEALLEKSKKNISLLEKE
REDLYAKIQAGEGETAVLNQLQEKNHALQEQLTQLTEKLKNQSESHKQAQENLHEQVQEQ
KSQLRASQDRVLALEATLNEVTSQLNESKEKMVQLDLQIKAKTELLLAAEAAKTAQRVDL
QNHLDTAQNALQDKQQELNKVNAQLEQVTAKLNDKQEYSIQLEANLKEYKEKHLNLEQKS
EALEGQLKKLETDLISVKANREQTTQELQQQKQQSAQMELKSAELSKQLEEEKGLVSSMK
LELQKKVESLQQSKEFISKQDQERNSLKENIEKLKQDLEKISGKMQDAVTSLEKTKLERD
ALQKDLAETKKKLSESSKSLQESRDQLEKEKLKGKKTVENMEKSQEEVKLNLQRQVDATA
KEVNELKSMLENKQEESTQTKAELDKARGYVAKLHSAIKEKEKAEQELQTELKKMHETSD
QEKVQHKSEIEAMTTQLAQKAEQEGKLQQQVKGLTSELETEKGKVSDLQKSHKLLQEKVN
SLQSDMYGKESEVSAIRQDLKNTEEKLILAQEELKTNRNEVNGHKKLIQELTAVRGTLEQ
DIAKNKNLLKEREKTLQELQEQKVLIEKDISDEKLKVTNLNSLNEKLKGELIQTREELKS
IKDECQKKTSSFEDAKQLLIQQKLELQAKLDSSASVLQQEKNSQQALKEDIKKKQEDWKK
HSTEMREKLSAEAKEKEEQKKKHEENESKLNMQITALNENLATLKKEWQSSQRRVGELEK
QTDDLRGEIAVLEATVQNNQDDRRALLERCLKSEGEIEKLQAKIFELRKKVDESSYAMEE
LGRENQSLQIKHNQALSRKWTEDHEVQNCMSCGRGFSVTIRRHHCRQCGNIFCHECSSKN
ALTPSSKKAVRVCDTCFGDLQG
NT seq 4209 nt NT seq  +upstreamnt  +downstreamnt
atgttcaggaggattttacagctgactcctggcagagttggctcacagaactctgaatct
gactcatcagccactccaggaaatgctgaaagctcatcagagggtttcatttgtccgctg
tgtatgaaatcccatgcaacagctgaagaactttttgtgcactatgaagcatctcacgaa
cctgccaatgaccctggtcaaggaggacaaaccaatctgtcgccaaaaagagatgaagtg
ctcttacttcgtcaggaagtcaaagatttacagacctcattaaaggaagaaaaatggttt
tcagaagagttgaagaaagagttggaaaatgttcaagggcaactgaagcaaaacacaatt
tcagatgggatgaccacaattgcagctacagagcttcagtctttagaacagaagttagaa
gaggcccagacagaaatgtttaatataaagcaaatgaaggatttatttgaacagaaagca
gctcaacaggctactgaagtagttgatttaaaggcatcatatgatgaagagaagagtaac
ttggcagctgcacgggagaaagtaaaaggtttaacacaagatctggattcaaagttacac
gtgattgaagacttgaagaatgagctgcttcagcgacctgggattgaagatgttgctgtg
ttgaagaaggagcttgtccaggtccagacgctgatggacaaaacaacgctagatgctgaa
aatgaatcagagaagctgaaagatgagtgcagacagctgcaggcacaaatctctaactct
gaggtgactattactcaactgaaagctgaacttgctaaaggccctcaagaagttgcagtt
tatgtccaggaattgcagcaactcaaaactgctttgactgagttaaatcaaaaacatgat
agtttgatggaaaaatttttgaagaaggaattggattacacccagcttgaggagaaacaa
aatgaggagtccactgcaaggaaaaacctgcaagtccttctcaatcagaaggacgtggag
ttccagcaattgcaagctcggttctctgcaagagacatgtcgctgcagaccgttaaggct
gaggtgggcgagaaggctgagacaaatcagaaactaaaagcggaactctcagaagtcgaa
accaaatatcagcatctcaaagccgaatttaagcagcttcagcagcaacgggaagagaag
gagcagcttagtttgcagcagcaaagtgagatcaatcagcttcacagcaagttactggag
acagagcgccaactaggggaagctcatgggaggctgaaggagcagaggcagctgtctgct
gagaaactgatggacaaggagcagcaggtggctgatctacagctgaaactctcacgtgct
gaggagcagctcaaagaaaagacttccgcgtctactgacttgcagcatcaattggaaaag
ataaggcaacagcatcaggaacagaccaacctccagcagaataccacatccaaattgaga
gaagcccaaaatgatttagaacaagtcttacggcagattggggacaaagaccagaaaatc
cagaaccttgaagcactattggagaaaagcaaaaagaacatttctcttcttgaaaaagaa
cgagaagatttatatgccaaaattcaagctggtgaaggagaaactgcagttctaaaccaa
cttcaagagaaaaaccacgctttgcaggaacagttaacccagcttactgagaagttaaaa
aatcaatcagaaagtcacaaacaagcccaggaaaacttgcatgagcaggttcaggagcag
aagtcccaactcagagcctcccaagatcgtgtcctggcacttgaggcaacacttaatgaa
gtcaccagtcagctaaatgagagcaaagagaaaatggttcaactggatttacagatcaaa
gcaaaaactgaacttttgttagcagcagaggcagcaaagacagcgcaaagagtagatctt
cagaaccacttggatacagcccaaaatgcactgcaggataagcaacaggaattaaacaaa
gtgaacgcacaactggaacaagtaacagcaaagttaaatgacaagcaggagtacagcatt
caactggaggcgaaccttaaggagtacaaagagaagcaccttaatctggaacaaaagtct
gaagctctggaagggcagcttaagaaacttgaaacagatctaatcagtgtgaaagcaaac
cgggaacagacaacccaggagctgcagcagcagaagcagcagagcgctcagatggaattg
aaatctgcagagctgagcaagcagttagaagaggagaaaggactggtatcaagtatgaaa
ctggaactacagaagaaagtggagtctctccagcagtcaaaggaattcatttcaaaacaa
gatcaagaaaggaacagtttgaaggagaatatagaaaagttaaagcaagacctggagaaa
atatcaggcaaaatgcaagatgccgtgacaagcctagagaaaaccaaactggagagagac
gctttgcaaaaagatcttgcagagaccaagaagaaattatctgagagcagcaaatcttta
caggaatcaagagatcaactggaaaaagaaaaactgaaaggaaagaaaacagttgaaaac
atggagaagtcacaggaagaagtgaaattgaatctacaaagacaggtggatgcaactgca
aaggaggtgaatgagctcaagtctatgctggaaaataagcaggaggaatccacccagaca
aaggctgagttggataaagcccgtggctacgttgcaaagctgcacagtgctatcaaagaa
aaggagaaagctgagcaggagctccagacagaactgaaaaagatgcatgaaacttcagat
caggagaaagtgcaacacaaatctgagattgaagccatgaccactcagttagcacaaaag
gcagaacaagaaggaaaattacagcagcaagtgaaaggattaaccagtgaactggaaact
gagaaaggaaaagtgtctgatctgcagaagtcccacaaactccttcaggagaaagtgaat
agccttcagtcagatatgtacgggaaagagtcagaagtatctgcaatacggcaggatctg
aaaaatacagaggaaaagcttattcttgcacaggaagagctaaaaacaaacaggaatgaa
gtcaatggccacaaaaagcttatacaagaactaactgctgtgagagggaccttggagcag
gatatagctaaaaataagaacttgctgaaggaacgggaaaaaacactgcaggaactgcag
gagcagaaggtcttaatagagaaggacataagtgatgaaaaactgaaagtaactaatcta
aactccttaaatgagaagcttaagggagaattaatccagactagagaagaactaaagagc
atcaaagatgaatgccaaaagaaaaccagcagttttgaggatgccaaacagctactaatc
cagcagaagctggagttgcaggccaaacttgacagctcagcttcagttctacaacaggaa
aagaatagccaacaggctctgaaggaggacatcaagaaaaagcaagaggactggaaaaaa
catagcacggagatgagagagaaattgtctgcagaagcaaaagaaaaagaagaacaaaag
aagaaacatgaggagaatgagtcaaagctaaacatgcagattacagctttaaatgagaac
ctggcaacgttaaagaaggaatggcagagcagccaacgtagggtcggtgagctggagaag
caaacagacgacctgcggggagagattgcagtattagaagcaacagtccaaaacaatcag
gacgacagacgtgctttgttagaaaggtgtcttaaaagcgagggtgaaattgaaaagctc
caagccaaaattttcgaactgcggaaaaaagtagatgaatcttcttatgcaatggaggaa
cttggcagggaaaaccaatcactacagataaagcacaaccaagcactcagtaggaagtgg
acagaggaccacgaagtgcagaactgcatgtcatgtggcagaggattttctgtaacaata
agaaggcaccactgtagacagtgtggaaatatcttctgtcatgaatgttcctcgaagaat
gccttaacgccctcctccaaaaaagctgtgcgtgtttgtgatacatgttttggtgacctg
caaggatag

DBGET integrated database retrieval system