KEGG   Xenopus tropicalis (western clawed frog): 100216064Help
Entry
100216064         CDS       T01011                                 

Gene name
usp2, ubp41, usp9
Definition
ubiquitin specific peptidase 2 (EC:3.1.2.15)
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100216064 (usp2)
Peptidases [BR:xtr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100216064 (usp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 383 aa AA seqDB search
MRTHTLRIHGIGAGREHQIPGTVILSSIVDFMLHRAKSSKHVQGLVGLRNLGNTCFMNSI
LQCLSNTKDLRDYCLQNSYRRDLSSKKCNTAIMEEFARLLQAIWTSSANEVVSPSEFKTQ
IQKYAPRFMGYNQQDAQEFLRFLLDGLHNEVNRVTVKPRPSSQDLDHMPDSEKGKHMWKR
YLEREDSRIVELFVGQLKSSLTCTECGYCSTVFDPFWDLSLPIAKKSASEVSLVDCMRLF
TKEDVLDGDEKPTCCRCKARRRCTKKFTIQKFPKILVLHLKRFSEGRIRSGKLSTFVNFP
LKDLDLREFSSESNPHATYNLYAVSNHSGTTMGGHYTAYCKNPSNGEWYTFNDSRVTAMS
SNQVRSSDAYVLFYELSGPSSRM
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacccacactctaagaatacatggcataggtgctggcagagagcaccaaataccc
ggaacagtcatactttccagcattgtggatttcatgctccacagagcaaagtcttccaaa
cacgtacagggtctagttggccttcggaatctgggtaatacgtgttttatgaactccata
ctgcaatgtttaagcaataccaaggacctacgagattactgtctgcagaattcatatcgt
cgagatctgagttcaaaaaaatgtaatactgcaattatggaagagtttgcacgattgctc
caggcaatttggactagttcagccaatgaagtagtgagcccttctgagttcaaaactcag
atacagaaatatgctcctcgcttcatgggatataaccagcaagacgctcaggaatttcta
cgatttctcttggatggtttacacaatgaagtcaacagggtaacagtcaaacccagacct
tccagccaggatttggaccatatgcctgactcggagaaaggcaaacatatgtggaagcga
tatctggagagggaggacagcagaattgtggaactgtttgttggccagctgaagagttcc
ctcacctgcacagaatgcggatactgttccactgtatttgacccattctgggacctctca
cttccaatagctaagaagagtgcctctgaagtatccctcgtagattgtatgcgtcttttt
actaaggaagatgttttagatggtgacgaaaagccaacatgctgcagatgtaaagctcgc
agaaggtgcacaaagaaattcaccatccaaaaattccctaagattcttgtgcttcatcta
aagcgattttctgaagggcgcatcagaagtggcaaactctccacatttgtgaatttccct
cttaaagacctggatctgcgggagttctcttcagaatcgaaccctcatgcaacatataat
ctttacgctgtatccaatcactctggaaccactatgggaggacattacacagcctattgc
aaaaacccaagtaatggagagtggtacacatttaacgattctagagtcacagcaatgtct
tccaatcaggtcagaagtagtgatgcttatgttttattctacgagctgtctgggccttca
tccagaatgtaa

DBGET integrated database retrieval system