KEGG   Xenopus tropicalis (western clawed frog): 100216073Help
Entry
100216073         CDS       T01011                                 

Definition
uncharacterized LOC100216073
Orthology
K08958  
casein kinase 1, gamma [EC:2.7.11.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04340 Hedgehog signaling pathway
    100216073
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100216073
Protein kinases [BR:xtr01001]
 Serine/threonine protein kinases: CK1 group
  CK1 family [OT]
   100216073
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 410 aa AA seqDB search
MDFEKRGGKGETEEVKKMSKPTGSRTGGRGTGNSGVLMVGPNFRVGKKIGCGNFGELQLG
KNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGNSEGVPQVFYFGPCGKYNAMVLELLG
PSLEDLFDLCDRTFSLKTVLMIAIQLITRMEFVHTRSLIYRDVKPENFLMGRPGSKRQHT
IHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFM
YFLRGSLPWQGSKADTLKERYQKIGDTKRATPIEVLCESFPEEMATYLRYVRRLDFFERP
DYEYLRKLFTDLFDRNGFVFDFEYDWVGKPLPTPIGPIPTDTPQPSRDKAQPQTKNQVMS
STNGELNTDDPTAGHSNTPITAPAEVEVADDTKCCCFFKRRKRKALQRHK
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggattttgagaagcgaggtgggaagggagagacagaggaagtaaaaaaaatgtcgaaa
ccaaccggtagtaggactgggggccggggaacagggaactctggggtcctcatggtcggc
cccaacttcagggttgggaagaaaatcggctgtggaaacttcggtgaactgcagctggga
aaaaacctttatacaaatgaatatgtggccatcaaactggagccaatcaaatcaagagcg
cctcaactccatttggagtatagattttataaacagctgggaaattcagagggagttcct
caggtcttctacttcgggccttgcgggaagtacaacgctatggttctggagctgcttggg
cccagtctagaggacctgtttgacctctgcgaccgcactttctccctcaagaccgtccta
atgatagctattcaactgataacacggatggagtttgttcacacacgaagcttgatatat
cgagacgtcaagccagagaattttttaatggggcggccggggtccaagaggcagcacacc
attcatatcatcgacttcgggcttgccaaagaatacatagaccccgagaccaaaaaacac
atcccataccgagagcataagagccttactggcactgcccggtatatgagtatcaacaca
catttgggaaaagaacaaagcagaagggacgacctagaagcactgggccatatgtttatg
tacttcctgagaggcagtttgccctggcagggctcgaaggcggacacattgaaagaacgc
taccagaaaattggtgacaccaagcgagccacaccgatagaagtgctatgtgaaagtttc
ccagaggagatggccacttatctgagatatgttcgacgactggacttctttgagagaccg
gattacgaatacttaaggaagctcttcacagacctcttcgacaggaatggttttgtcttc
gatttcgagtacgactgggtcggcaagcctctccctacacctataggcccaatccccaca
gacacaccccagcctagcagagacaaagcacaaccgcagactaaaaaccaggtcatgagc
tccacaaacggagagctgaacacagatgacccgactgcaggacactccaacacccccatc
actgcacctgctgaggtagaggtggcagacgacacaaagtgctgttgtttttttaagcgg
agaaagaggaaagctcttcagaggcacaagtga

DBGET integrated database retrieval system