KEGG   Xenopus tropicalis (western clawed frog): 100216073Help
Entry
100216073         CDS       T01011                                 

Definition
uncharacterized LOC100216073
Orthology
K08958  
casein kinase 1, gamma [EC:2.7.11.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Hedgehog signaling pathway
Class
Environmental Information Processing; Signal transduction; Hedgehog signaling pathway [PATH:xtr04340]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 410 aa AA seqDB search
MDFEKRGGKGETEEVKKMSKPTGSRTGGRGTGNSGVLMVGPNFRVGKKIGCGNFGELQLG
KNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGNSEGVPQVFYFGPCGKYNAMVLELLG
PSLEDLFDLCDRTFSLKTVLMIAIQLITRMEFVHTRSLIYRDVKPENFLMGRPGSKRQHT
IHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFM
YFLRGSLPWQGSKADTLKERYQKIGDTKRATPIEVLCESFPEEMATYLRYVRRLDFFERP
DYEYLRKLFTDLFDRNGFVFDFEYDWVGKPLPTPIGPIPTDTPQPSRDKAQPQTKNQVMS
STNGELNTDDPTAGHSNTPITAPAEVEVADDTKCCCFFKRRKRKALQRHK
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggattttgagaagcgaggtgggaagggagagacagaggaagtaaaaaaaatgtcgaaa
ccaaccggtagtaggactgggggccggggaacagggaactctggggtcctcatggtcggc
cccaacttcagggttgggaagaaaatcggctgtggaaacttcggtgaactgcagctggga
aaaaacctttatacaaatgaatatgtggccatcaaactggagccaatcaaatcaagagcg
cctcaactccatttggagtatagattttataaacagctgggaaattcagagggagttcct
caggtcttctacttcgggccttgcgggaagtacaacgctatggttctggagctgcttggg
cccagtctagaggacctgtttgacctctgcgaccgcactttctccctcaagaccgtccta
atgatagctattcaactgataacacggatggagtttgttcacacacgaagcttgatatat
cgagacgtcaagccagagaattttttaatggggcggccggggtccaagaggcagcacacc
attcatatcatcgacttcgggcttgccaaagaatacatagaccccgagaccaaaaaacac
atcccataccgagagcataagagccttactggcactgcccggtatatgagtatcaacaca
catttgggaaaagaacaaagcagaagggacgacctagaagcactgggccatatgtttatg
tacttcctgagaggcagtttgccctggcagggctcgaaggcggacacattgaaagaacgc
taccagaaaattggtgacaccaagcgagccacaccgatagaagtgctatgtgaaagtttc
ccagaggagatggccacttatctgagatatgttcgacgactggacttctttgagagaccg
gattacgaatacttaaggaagctcttcacagacctcttcgacaggaatggttttgtcttc
gatttcgagtacgactgggtcggcaagcctctccctacacctataggcccaatccccaca
gacacaccccagcctagcagagacaaagcacaaccgcagactaaaaaccaggtcatgagc
tccacaaacggagagctgaacacagatgacccgactgcaggacactccaacacccccatc
actgcacctgctgaggtagaggtggcagacgacacaaagtgctgttgtttttttaagcgg
agaaagaggaaagctcttcagaggcacaagtga

DBGET integrated database retrieval system